Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Neutrophil collagenase  

UniProtKB / Swiss-Prot ID :  MMP8_HUMAN

Gene Name (Synonyms) : 
MMP8, CLG1  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasmic granule. Secreted, extracellular space, extracellular matrix (Probable). Note=Stored in intracellular granules. 

Protein Function :  Can degrade fibrillar type I, II, and III collagens. 

Protein Sequence MFSLKTLPFLLLLHVQISKAFPVSSKEKNTKTVQDYLEKFYQLPSNQYQSTRKNGTNVIVEKLKEMQRFF...
Predicted Secondary Structure CCCCHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHC...
Protein Variant
LocationDescription
3S -> C (in dbSNP:rs17099450). VAR_025036
32T -> I (in dbSNP:rs3765620). VAR_025037
87K -> E (in dbSNP:rs1940475). VAR_006730
154G -> E (in dbSNP:rs35056226). VAR_025038
193D -> V (in dbSNP:rs34428739). VAR_025039
246N -> Y (in dbSNP:rs35243553). VAR_025040
436V -> A (in dbSNP:rs34009635). VAR_025041
460K -> T (in dbSNP:rs35866072). VAR_025042
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
112N-linked (GlcNAc...).WERTNLTYR
CCEEEEEEE
36.28UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
CCL2_HUMANin vitro
in vivo
HPRD:00385HPRD12149192
9558113
ONCM_HUMANENSP00000236826STRING
TIMP2_HUMANENSP00000236826STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures