Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Monocarboxylate transporter 8  

UniProtKB / Swiss-Prot ID :  MOT8_HUMAN

Gene Name (Synonyms) : 
SLC16A2, MCT8, XPCT  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cell membrane; Multi-pass membrane protein (By similarity). 

Protein Function :  Very active and specific thyroid hormone transporter. Stimulates cellular uptake of thyroxine (T4), triiodothyronine (T3), reverse triiodothyronine (rT3) and diidothyronine. Does not transport Leu, Phe, Trp or Tyr (By similarity). 

Transmembrane Topology (topPTM) : MOT8_HUMAN 

Protein Sequence MALQSQASEEAKGPWQEADQEQQEPVGSPEPESEPEPEPEPEPVPVPPPEPQPEPQPLPDPAPLPELEFE...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC...
Protein Variant
LocationDescription
120S -> F (in MCT8 deficiency). VAR_059054
150A -> V (in MCT8 deficiency). VAR_022348
156Missing (in MCT8 deficiency). VAR_059055
161V -> M (in MCT8 deficiency). VAR_059056
323I -> L (in dbSNP:rs12849411). VAR_057723
360L -> W (in MCT8 deficiency). VAR_059057
397L -> P (in MCT8 deficiency). VAR_022349
427Missing (in MCT8 deficiency). VAR_059058
438L -> P (in MCT8 deficiency). VAR_022350
490G -> R (in MCT8 deficiency). VAR_059059
494L -> P (in MCT8 deficiency). VAR_059060
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MALQSQ
---CCCCCC
17.82UniProtKB
Link-
80PhosphothreonineEPEPTPTVE
CCCCCCCCC
29.90Phosphositeplus
Link-
82PhosphothreonineEPTPTVETR
CCCCCCCCC
33.19Phosphositeplus
Link-
193Phosphoserine.SFTSSLSLR
HHHHHHHHH
20.94UniProtKB
Link-
195Phosphoserine.TSSLSLRYF
HHHHHHHHH
16.85UniProtKB
Link-
267PhosphoserineFQVLSTFMF
HHHHHHHHH
22.27HPRD
Link-
290PhosphothreonineSSQDTPSKR
CCCCCCCCC
23.09Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
THBG_HUMANin vitro
in vivo
HPRD:02106HPRD12871948
THA_HUMANin vitro
in vivo
HPRD:02106HPRD12871948
- top -

Disease Reference
Kegg disease
H00650 Allan-Herndon-Dudley syndrome; Monocarboxylate transporter 8 deficiency
OMIM disease
300523Monocarboxylate transporter 8 deficiency (MCT8 deficiency)
Drug Reference
DrugBank
DB00149L-Leucine
DB00150L-Tryptophan
DB00135L-Tyrosine
DB00451Levothyroxine
DB01583Liotrix
DB00119Pyruvic acid
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
Phosphorylation
ReferencePubMed
"Global, in vivo, and site-specific phosphorylation dynamics insignaling networks.";
Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,Mann M.;
Cell 127:635-648(2006).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-193 AND SER-195, ANDMASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures