Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Mannose-P-dolichol utilization defect 1 protein  

UniProtKB / Swiss-Prot ID :  MPU1_HUMAN

Gene Name (Synonyms) : 
MPDU1  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Membrane; Multi-pass membrane protein (Potential). 

Protein Function :  Required for normal utilization of mannose-dolichol phosphate (Dol-P-Man) in the synthesis of N-linked and O-linked oligosaccharides and GPI anchors (By similarity). 

Transmembrane Topology (topPTM) : MPU1_HUMAN 

Protein Sequence MAAEADGPLKRLLVPILLPEKCYDQLFVQWDLLHVPCLKILLSKGLGLGIVAGSLLVKLPQVFKILGAKS...
Predicted Secondary Structure CCCCCCCCHHHHHHHHCCCHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC...
Protein Variant
LocationDescription
73G -> E (in CDG1F). VAR_021388
74L -> S (in CDG1F). VAR_021389
119L -> P (in CDG1F). VAR_021390
225G -> S (in dbSNP:rs16956808). VAR_047757
229A -> T (in dbSNP:rs10852891). VAR_047758
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAAEAD
---CCCCCC
17.63UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
QRIC2_HUMANphysical interactionEBI-1062069
intact17353931
MO4L2_HUMANphysical interactionEBI-1069428
intact17353931
AAAT_HUMANphysical interactionEBI-1071249
intact17353931
RS3A_HUMANphysical interactionEBI-1071896
intact17353931
PMVK_HUMANphysical interactionEBI-1073072
intact17353931
SHBG_HUMANyeast 2-hybridHPRD:04951HPRD15862967
- top -

Disease Reference
Kegg disease
H00118 Congenital disorders of glycosylation (CDG) type I
OMIM disease
609180Congenital disorder of glycosylation 1F (CDG1F)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures