Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Major sperm protein 10/36/56/76  

UniProtKB / Swiss-Prot ID :  MSP10_CAEEL

Gene Name (Synonyms) : 
msp-10 K07F5.2
msp-36 C04G2.4
msp-56 K07F5.3
msp-76 ZK1251.6  

Species :  Caenorhabditis elegans. 

Subcellular Localization :  Cell projection, pseudopodium. Cytoplasm, cytoskeleton. 

Protein Function :  Central component in molecular interactions underlying sperm crawling. Forms an extensive filament system that extends from sperm villipoda, along the leading edge of the pseudopod. 

Protein Sequence MAQSVPPGDIQTQPNAKIVFNAPYDDKHTYHIKVINSSARRIGYGIKTTNMKRLGVDPPCGVLDPKEAVL...
Predicted Secondary Structure CCCCCCCCCEEECCCCEEEECCCCCCCEEEEEEEECCCCCEEEEEEEECCCEEEEECCCCCEECCCCEEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
There are no experimentally verified PTM sites.
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures