Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  5-formyltetrahydrofolate cyclo-ligase  

UniProtKB / Swiss-Prot ID :  MTHFS_HUMAN

Gene Name (Synonyms) : 
MTHFS  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  Contributes to tetrahydrofolate metabolism. Helps regulate carbon flow through the folate-dependent one-carbon metabolic network that supplies carbon for the biosynthesis of purines, thymidine and amino acids. 

Protein Sequence MAAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKD...
Predicted Secondary Structure CCCHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCHHHHCCCEEEEEECCCCCCCHHHHHH...
Protein Variant
LocationDescription
202T -> A (in dbSNP:rs8923). VAR_034115
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAAAAV
---CCCHHH
13.05UniProtKB
Link
10Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VSSAKRSLR
HHHHHHHHH
44.46Phosphositeplus
Link
46PhosphotyrosineAHSEYQKSK
CCCHHHHCC
25.02HPRD
Link
46PhosphotyrosineAHSEYQKSK
CCCHHHHCC
25.02Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
T22D4_HUMANphysical interactionEBI-759727
intact16189514
T22D4_HUMANyeast 2-hybridHPRD:09174HPRD16189514
C1TC_HUMANENSP00000258874STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures