Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  5-formyltetrahydrofolate cyclo-ligase  

UniProtKB / Swiss-Prot ID :  MTHFS_RABIT

Gene Name (Synonyms) : 
MTHFS  

Species :  Oryctolagus cuniculus (Rabbit). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  Contributes to tetrahydrofolate metabolism. Helps regulate carbon flow through the folate-dependent one-carbon metabolic network that supplies carbon for the biosynthesis of purines, thymidine and amino acids (By similarity). 

Protein Sequence AAAAAVSGAKRSLRAELKQRLRAISAEERLRCQRLLTQKVIAHRQYQKSQRISIFLSMPDEIETEEIIKD...
Predicted Secondary Structure CCCHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCHHHHCCCEEEEEECCCCCCCHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
1N-acetylalanine.----AAAAA
----CCCHH
19.67UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Primary structure and tetrahydropteroylglutamate binding site ofrabbit liver cytosolic 5,10-methenyltetrahydrofolate synthetase.";
Maras B., Stover P., Valiante S., Barra D., Schirch V.;
J. Biol. Chem. 269:18429-18433(1994).
Cited for: PROTEIN SEQUENCE.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures