Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  N-methyl-L-tryptophan oxidase  

UniProtKB / Swiss-Prot ID :  MTOX_ECOLI

Gene Name (Synonyms) : 
solA b1059, JW1046  

Species :  Escherichia coli (strain K12). 

Subcellular Localization :   

Protein Function :  Catalyzes the oxidative demethylation of N-methyl-L- tryptophan. Can also use other N-methyl amino acids, including sarcosine, which, however, is a poor substrate. 

Protein Sequence MKYDLIIIGSGSVGAAAGYYATRAGLNVLMTDAHMPPHQHGSHHGDTRLIRHAYGEGEKYVPLVLRAQTL...
Predicted Secondary Structure CEEEEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCEEEECCCCCHHHHHHHHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
308S-8alpha-FAD cysteine.YGAACTYDN
HCCCCCCCC
3.43UniProtKB
Link
357Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-...)FAQDKKSDF
HHHCCCCCC
41.94PupDB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures