Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Myelin expression factor 2  

UniProtKB / Swiss-Prot ID :  MYEF2_MOUSE

Gene Name (Synonyms) : 
Myef2, Kiaa1341, Mef2  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Nucleus. 

Protein Function :  Transcriptional repressor of the myelin basic protein gene (MBP). Binds to the proximal MB1 element 5'-TTGTCC-3' of the MBP promoter. Its binding to MB1 and function are inhibited by PURA. 

Protein Sequence MADADKSEAAAGDDGSQQQPAEPRRDTHPGEPEKPPRSSANGVKMENDESVKEEKSDLKEKSTGNKKANR...
Predicted Secondary Structure CCCCCCCHHHCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
422PhosphoserineGFGDSFGRL
HCCCCCCCC
29.94Phosphositeplus
Link-
473PhosphoserineDRMSSSFDR
CCCCCCCCC
26.19Phosphositeplus
Link-
474PhosphoserineRMSSSFDRM
CCCCCCCCC
24.70Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures