Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Myosin-10  

UniProtKB / Swiss-Prot ID :  MYH10_RAT

Gene Name (Synonyms) : 
Myh10  

Species :  Rattus norvegicus (Rat). 

Subcellular Localization :   

Protein Function :  Involved with LARP6 in the stabilization of type I collagen mRNAs for CO1A1 and CO1A2 (By similarity). Cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping. 

Protein Sequence MAQRTGLEDPERYLFVDRAVIYNPATQADWTAKKLVWIPSERHGFEAASIKEERGDEVMVELAENGKKAM...
Predicted Secondary Structure CCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCEEEEECCCCCEEEEEEEECCCCEEEEEECCCCCEEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
1938PhosphoserineISFSSSRSG
CCCCCCCCC
27.97Phosphositeplus
Link-
1938Phosphoserine.ISFSSSRSG
CCCCCCCCC
27.97UniProtKB
Link-
1956PhosphoserineSLELSDDDT
EEEECCCCC
29.62Phosphositeplus
Link-
1956Phosphoserine.SLELSDDDT
EEEECCCCC
29.62UniProtKB
Link-
1960PhosphothreonineSDDDTESKT
CCCCCCCCC
49.50Phosphositeplus
Link-
1960Phosphothreonine.SDDDTESKT
CCCCCCCCC
49.50UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Quantitative phosphoproteomics of vasopressin-sensitive renal cells:regulation of aquaporin-2 phosphorylation at two sites.";
Hoffert J.D., Pisitkun T., Wang G., Shen R.-F., Knepper M.A.;
Proc. Natl. Acad. Sci. U.S.A. 103:7159-7164(2006).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1938; SER-1956 ANDTHR-1960, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures