Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Myosin-14  

UniProtKB / Swiss-Prot ID :  MYH14_HUMAN

Gene Name (Synonyms) : 
MYH14, KIAA2034 FP17425  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  Cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping (By similarity). 

Protein Sequence MAAVTMSVPGRKAPPRPGPVPEAAQPFLFTPRGPSAGGGPGSGTSPQVEWTARRLVWVPSELHGFEAAAL...
Predicted Secondary Structure CCEEEEECCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHCCCEEEEECCCCCEEEEEE...
Protein Variant
LocationDescription
120S -> L (in DFNA4A). VAR_037302
266I -> V. VAR_022866
334P -> A (in dbSNP:rs34498817). VAR_056176
376G -> C (in DFNA4A). VAR_022867
726R -> S (in DFNA4A; dbSNP:rs28940307). VAR_022868
933R -> L (in PNMHH). VAR_066338
976L -> F (in DFNA4A; dbSNP:rs28940306). VAR_022869
1154A -> V. VAR_066339
1209A -> E (in dbSNP:rs11669191). VAR_056177
1540V -> I (in dbSNP:rs680446). VAR_056178
1559N -> S. VAR_022870
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAAVTM
---CCEEEE
23.19UniProtKB
Link-
252Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)FGNAKTVKN
HCCCCCCCC
58.83Phosphositeplus
Link
412PhosphoserineVTDFSRALL
HHHHHHHCC
21.32Phosphositeplus
Link
429Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DYVQKAQTK
EEEEECCCH
32.20Phosphositeplus
Link
669PhosphothreonineGMFRTVGQL
CCCCCHHHH
20.09HPRD
Link
778PhosphotyrosineDPNLYRVGQ
CHHHEEECC
15.19PhosphoELM
Link
778PhosphotyrosineDPNLYRVGQ
CHHHEEECC
15.19Phosphositeplus
Link
778Phosphotyrosine.DPNLYRVGQ
CHHHEEECC
15.19UniProtKB
Link
845Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AAYLKLRHW
HHHHHHHHH
30.69Phosphositeplus
Link-
880Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)QELQKVQEL
HHHHHHHHH
59.52Phosphositeplus
Link-
1585PhosphothreonineRLEVTVQAL
HHHHHHHHH
9.49HPRD
Link-
1585PhosphothreonineRLEVTVQAL
HHHHHHHHH
9.49Phosphositeplus
Link-
1591PhosphothreonineQALKTQHER
HHHHHHHHH
35.69HPRD
Link-
1591PhosphothreonineQALKTQHER
HHHHHHHHH
35.69Phosphositeplus
Link-
1969PhosphoserineEGVASDEEA
HCCCCCCHH
43.05HPRD
Link-
1969PhosphoserineEGVASDEEA
HCCCCCCHH
43.05Phosphositeplus
Link-
1969Phosphoserine.EGVASDEEA
HCCCCCCHH
43.05UniProtKB
Link-
1983PhosphoserineGSGPSPEPE
CCCCCCCCC
45.48Phosphositeplus
Link-
1989PhosphoserineEPEGSPPAH
CCCCCCCCC
26.50HPRD
Link-
1989PhosphoserineEPEGSPPAH
CCCCCCCCC
26.50Phosphositeplus
Link-
1989Phosphoserine.EPEGSPPAH
CCCCCCCCC
26.50UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
IKKA_HUMANphysical interactionMINT-48055MINT14743216
GFI1B_HUMANphysical interactionMINT-2876387MINT16713569
RT12_HUMANENSP00000262269STRING
- top -

Disease Reference
Kegg disease
OMIM disease
600652Deafness, autosomal dominant, 4A (DFNA4A)
614369Peripheral neuropathy, myopathy, hoarseness, and hearing loss (PNMHH)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Global survey of phosphotyrosine signaling identifies oncogenickinases in lung cancer.";
Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J.,Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L.,Mitchell J., Wetzel R., Macneill J., Ren J.M., Yuan J.,Bakalarski C.E., Villen J., Kornhauser J.M., Smith B., Li D., Zhou X.,Gygi S.P., Gu T.-L., Polakiewicz R.D., Rush J., Comb M.J.;
Cell 131:1190-1203(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-778, AND MASSSPECTROMETRY.
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1969 AND SER-1989, ANDMASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures