Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Myosin-9  

UniProtKB / Swiss-Prot ID :  MYH9_RAT

Gene Name (Synonyms) : 
Myh9  

Species :  Rattus norvegicus (Rat). 

Subcellular Localization :  Cytoplasm, cytoskeleton (By similarity). Cytoplasm, cell cortex (By similarity). Note=Colocalizes with actin filaments at lamellipodia margins and at the leading edge of migrating cells (By similarity). 

Protein Function :  Cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping. 

Protein Sequence MAQQAADKYLYVDKNFINNPLAQADCGAKKLVWVPSTKNGFEPASLKEEVGEEAIVELVENGKKVKVNKD...
Predicted Secondary Structure CCCHHHHHCCCCCHHHCCCCCCCCCCCCCCCCEEECCCCCEEEEEEEECCCCEEEEEEECCCCEEECCHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
638PhosphothreonineGAFKTRKGM
CCCCCCCCC
31.03Phosphositeplus
Link-
638Phosphothreonine.GAFKTRKGM
CCCCCCCCC
31.03UniProtKB
Link-
1800PhosphoserineQEMESAVKS
HHHHHHHHH
36.73Phosphositeplus
Link-
1800Phosphoserine.QEMESAVKS
HHHHHHHHH
36.73UniProtKB
Link-
1917PhosphoserineREVSSLKNK
CHHHHHHHH
48.84Phosphositeplus
Link-
1940PhosphothreonineVRKGTGDCS
HHHCCCCCC
32.65Phosphositeplus
Link-
1944PhosphoserineTGDCSDEEV
CCCCCCCCC
53.44Phosphositeplus
Link-
1944Phosphoserine.TGDCSDEEV
CCCCCCCCC
53.44UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Quantitative phosphoproteomics of vasopressin-sensitive renal cells:regulation of aquaporin-2 phosphorylation at two sites.";
Hoffert J.D., Pisitkun T., Wang G., Shen R.-F., Knepper M.A.;
Proc. Natl. Acad. Sci. U.S.A. 103:7159-7164(2006).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-638; SER-1800 ANDSER-1944, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures