Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Unconventional myosin-Vc  

UniProtKB / Swiss-Prot ID :  MYO5C_HUMAN

Gene Name (Synonyms) : 
MYO5C  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  May be involved in transferrin trafficking. Likely to power actin-based membrane trafficking in many physiologically crucial tissues. 

Protein Sequence MAVAELYTQYNRVWIPDPEEVWKSAEIAKDYRVGDKVLRLLLEDGTELDYSVNPESLPPLRNPDILVGEN...
Predicted Secondary Structure CCCCCCCCCCCEEEEECCCCCEEEEEEEECCCCCCCEEEEEECCCCEEEEECCHHHCCCCCCCCCCHHHH...
Protein Variant
LocationDescription
172R -> C (in dbSNP:rs55686434). VAR_061365
522L -> P. VAR_010646
634L -> S. VAR_010647
1075E -> K (in dbSNP:rs3825801). VAR_024544
1396P -> L (in dbSNP:rs17650440). VAR_056186
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAVAEL
---CCCCCC
22.11UniProtKB
Link-
208Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VGNAKTTRN
HCCCCCCCC
55.20Phosphositeplus
Link-
526PhosphotyrosineLQKLYNNFV
HHHHHHHHC
18.33Phosphositeplus
Link-
911Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GLVEKLTSL
HHHHHHHHH
49.97Phosphositeplus
Link-
914PhosphoserineEKLTSLAAL
HHHHHHHHH
26.84HPRD
Link-
1104PhosphoserineREKMSEITK
HHHHHHHHH
36.59Phosphositeplus
Link-
1104Phosphoserine.REKMSEITK
HHHHHHHHH
36.59UniProtKB
Link-
1157PhosphoserineSHFQSQKDC
HHHHHHHHH
37.95HPRD
Link-
1347N6-acetyllysineKTIGKANDV
HHCCHHCCC
39.92Phosphositeplus
Link-
1358N6-acetyllysineSSGPKEYLG
CCCCHHHHH
63.62Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column.";
Imami K., Sugiyama N., Kyono Y., Tomita M., Ishihama Y.;
Anal. Sci. 24:161-166(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1104, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures