Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Myelin P2 protein  

UniProtKB / Swiss-Prot ID :  MYP2_HUMAN

Gene Name (Synonyms) : 
PMP2  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm (By similarity). 

Protein Function :  May play a role in lipid transport protein in Schwann cells. May bind cholesterol. 

Protein Sequence MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQE...
Predicted Secondary Structure CCCCCCEEEEEEEECCHHHHHHHHCCCHHHHHHHHHCCCEEEEEEECCEEEEEEECCCCEEEEEEEECEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylserine.---MSNKFL
---CCCCCC
49.04UniProtKB
Link
69Glutamine amideFKLGQEFEE
EEECEEEEE
63.74HPRD
Link
73Glutamic acid 1-amideQEFEETTAD
EEEEEECCC
57.70HPRD
Link
118S-cysteinyl 3-(oxidosulfanyl)alanine (Cys-Cys)MVAECKMKG
EEEEEEECC
3.63HPRD
Link
125S-cysteinyl 3-(oxidosulfanyl)alanine (Cys-Cys)KGVVCTRIY
CCEEEEEEE
1.64HPRD
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"The complete amino acid sequence of human P2 protein.";
Suzuki M., Kitamura K., Sakamoto Y., Uyemura K.;
J. Neurochem. 39:1759-1762(1982).
Cited for: PROTEIN SEQUENCE OF 2-132, AND ACETYLATION AT SER-2.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures