Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Mitotic-spindle organizing protein 2B  

UniProtKB / Swiss-Prot ID :  MZT2B_HUMAN

Gene Name (Synonyms) : 
MZT2B, FAM128B, MOZART2B  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm, cytoskeleton, centrosome. Cytoplasm, cytoskeleton, spindle. 

Protein Function :   

Protein Sequence MAAQGVGPGPGSAAPPGLEAARQKLALRRKKVLSTEEMELYELAQAAGGAIDPDVFKILVDLLKLNVAPL...
Predicted Secondary Structure  -
Protein Variant
LocationDescription
118A -> V (in dbSNP:rs1043059). VAR_043853
155R -> Q (in dbSNP:rs1043152). VAR_043854
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
34PhosphoserineKKVLSTEEM
36.44HPRD
Link-
34PhosphoserineKKVLSTEEM
36.44Phosphositeplus
Link-
35PhosphothreonineKVLSTEEME
31.63Phosphositeplus
Link-
41PhosphotyrosineEMELYELAQ
8.80Phosphositeplus
Link-
139PhosphoserinePRQPSATRL
33.65HPRD
Link-
139PhosphoserinePRQPSATRL
33.65Phosphositeplus
Link-
152PhosphoserineGPGKSPTRG
37.10HPRD
Link-
152PhosphoserineGPGKSPTRG
37.10Phosphositeplus
Link-
158PhosphothreonineTRGST
45.51Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures