Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  GPI-linked NAD(P)(+)--arginine ADP-ribosyltransferase 1  

UniProtKB / Swiss-Prot ID :  NAR1_HUMAN

Gene Name (Synonyms) : 
ART1  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Sarcoplasmic reticulum membrane; Lipid- anchor, GPI-anchor. 

Protein Function :  Has ADP-ribosyltransferase activity toward GLP1R. 

Protein Sequence MQMPAMMSLLLVSVGLMEALQAQSHPITRRDLFSQEIQLDMALASFDDQYAGCAAAMTAALPDLNHTEFQ...
Predicted Secondary Structure CCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHH...
Protein Variant
LocationDescription
105P -> L (in dbSNP:rs35123761). VAR_034125
126P -> R (in dbSNP:rs35619488). VAR_034126
257L -> P (in dbSNP:rs2280134). VAR_053526
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
There are no experimentally verified PTM sites.
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
PDGFB_HUMANin vitroHPRD:03377HPRD11498506
CD38_HUMANENSP00000250693STRING
- top -

Disease Reference
Drug Reference
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures