Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Cytosolic Fe-S cluster assembly factor NARFL  

UniProtKB / Swiss-Prot ID :  NARFL_HUMAN

Gene Name (Synonyms) : 
NARFL, PRN  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  Component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. Required for maturation of extramitochondrial Fe/S proteins. Seems to negatively regulate the level of HIF1A expression, although this effect could be indirect. 

Protein Sequence MASPFSGALQLTDLDDFIGPSQECIKPVKVEKRAGSGVAKIRIEDDGSYFQINQDGGTRRLEKAKVSLND...
Predicted Secondary Structure CCCHHHHHHHHHCCHHHHCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCHHHHHHHHHH...
Protein Variant
LocationDescription
38V -> M (in dbSNP:rs8045850). VAR_053911
444H -> R (in dbSNP:rs7188554). VAR_053912
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
3Phosphoserine--MASPFSG
--CCCHHHH
25.77HPRD
Link-
49PhosphotyrosineDDGSYFQIN
CCCCEEEEC
12.67HPRD
Link-
49PhosphotyrosineDDGSYFQIN
CCCCEEEEC
12.67Phosphositeplus
Link-
102Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LDANKMAAP
HCCCCCCCC
31.47Phosphositeplus
Link-
224Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GSLVKDFFA
HHHHHHHHH
54.86Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures