Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  NADPH--cytochrome P450 reductase  

UniProtKB / Swiss-Prot ID :  NCPR_RABIT

Gene Name (Synonyms) : 
POR  

Species :  Oryctolagus cuniculus (Rabbit). 

Subcellular Localization :  Endoplasmic reticulum membrane; Peripheral membrane protein. Note=Anchored to the ER membrane by its N- terminal hydrophobic region. 

Protein Function :  This enzyme is required for electron transfer from NADP to cytochrome P450 in microsomes. It can also provide electron transfer to heme oxygenase and cytochrome B5. 

Protein Sequence MADSHGDTGATMPEAAAQEASVFSMTDVVLFSLIVGLITYWFLFRKKKEEVPEFTKIQAPTSSSVKESSF...
Predicted Secondary Structure CCCCCCCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MADSHG
---CCCCCC
27.32UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures