Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Nucleoside diphosphate kinase B  

UniProtKB / Swiss-Prot ID :  NDKB_RAT

Gene Name (Synonyms) : 
Nme2  

Species :  Rattus norvegicus (Rat). 

Subcellular Localization :  Cytoplasm. Cell membrane. 

Protein Function :  Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Negatively regulates Rho activity by interacting with AKAP13/LBC. Exhibits histidine protein kinase activity (By similarity). 

Protein Sequence MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNS...
Predicted Secondary Structure CCCHHHHHHEECCCCCCCCCHHHHHHHHHHCCCCEEHHHHCCCCHHHHHHHHHHHCCCCCHHHHHHHHCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
94PhosphothreonineMLGETNPAD
HHCCCCHHH
44.71Phosphositeplus
Link-
120PhosphoserineIIHGSDSVE
EEECCCCHH
16.73Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures