Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2  

UniProtKB / Swiss-Prot ID :  NDUA2_HUMAN

Gene Name (Synonyms) : 
NDUFA2  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Mitochondrion inner membrane; Peripheral membrane protein; Matrix side. 

Protein Function :  Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. 

Protein Sequence MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYA...
Predicted Secondary Structure CCCCHHHCCCCCCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCCHHHHHHHH...
Protein Variant
LocationDescription
50D -> N (in a breast cancer sample;somatic mutation).
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine---MAAAAA
---CCCCHH
13.05HPRD
Link-
2N-acetylalanine.---MAAAAA
---CCCCHH
13.05UniProtKB
Link-
7PhosphoserineAAAASRGVG
CCHHHCCCC
25.49HPRD
Link-
7PhosphoserineAAAASRGVG
CCHHHCCCC
25.49Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
ACPM_HUMANENSP00000252102STRING
NDUB4_HUMANENSP00000252102STRING
NDUB7_HUMANENSP00000252102STRING
NDUB3_HUMANENSP00000252102STRING
NDUAD_HUMANENSP00000252102STRING
NDUB5_HUMANENSP00000252102STRING
NDUC1_HUMANENSP00000252102STRING
NDUBA_HUMANENSP00000252102STRING
NDUB9_HUMANENSP00000252102STRING
NDUC2_HUMANENSP00000252102STRING
NDUB8_HUMANENSP00000252102STRING
NDUA7_HUMANENSP00000252102STRING
NDUA3_HUMANENSP00000252102STRING
NDUAB_HUMANENSP00000252102STRING
NDUAC_HUMANENSP00000252102STRING
NDUB1_HUMANENSP00000252102STRING
NDUA6_HUMANENSP00000252102STRING
NDUA4_HUMANENSP00000252102STRING
1B27_HUMANENSP00000252102STRING
1B58_HUMANENSP00000252102STRING
1B37_HUMANENSP00000252102STRING
1B51_HUMANENSP00000252102STRING
1B57_HUMANENSP00000252102STRING
1B13_HUMANENSP00000252102STRING
1B15_HUMANENSP00000252102STRING
1B18_HUMANENSP00000252102STRING
1B44_HUMANENSP00000252102STRING
1B45_HUMANENSP00000252102STRING
1B47_HUMANENSP00000252102STRING
1B49_HUMANENSP00000252102STRING
1B50_HUMANENSP00000252102STRING
1B52_HUMANENSP00000252102STRING
1B53_HUMANENSP00000252102STRING
1B54_HUMANENSP00000252102STRING
1B55_HUMANENSP00000252102STRING
1B56_HUMANENSP00000252102STRING
1B78_HUMANENSP00000252102STRING
1B35_HUMANENSP00000252102STRING
1B40_HUMANENSP00000252102STRING
1B82_HUMANENSP00000252102STRING
1B59_HUMANENSP00000252102STRING
NU6M_HUMANENSP00000252102STRING
NU1M_HUMANENSP00000252102STRING
NU4LM_HUMANENSP00000252102STRING
NU5M_HUMANENSP00000252102STRING
NU4M_HUMANENSP00000252102STRING
NU2M_HUMANENSP00000252102STRING
NU3M_HUMANENSP00000252102STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures