Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Nitrile hydratase subunit alpha  

UniProtKB / Swiss-Prot ID :  NHAA_RHOER

Gene Name (Synonyms) : 
nthA  

Species :  Rhodococcus erythropolis (Arthrobacter picolinophilus). 

Subcellular Localization :   

Protein Function :  NHase catalyzes the hydration of various nitrile compounds to the corresponding amides. Industrial production of acrylamide is now being developed using some of the enzymes of this class. 

Protein Sequence MSVTIDHTTENAAPAQAPVSDRAWALFRALDGKGLVPDGYVEGWKKTFEEDFSPRRGAELVARAWTDPEF...
Predicted Secondary Structure CCEECCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
113Cysteine sulfinic acid (-SO2H).VCSLCSCTA
EEEEECCCC
1.48UniProtKB
Link
113S-nitrosocysteineVCSLCSCTA
EEEEECCCC
1.48dbSNO
Link
115Cysteine sulfenic acid (-SOH).SLCSCTAWP
EEECCCCCC
2.69UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures