Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Notchless protein homolog 1  

UniProtKB / Swiss-Prot ID :  NLE1_HUMAN

Gene Name (Synonyms) : 
NLE1 HUSSY-07  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Nucleus, nucleolus. 

Protein Function :   

Protein Sequence MAAAVPDEAVARDVQRLLVQFQDEGGQLLGSPFDVPVDITPDRLQLVCNALLAQEDPLPLAFFVHDAEIV...
Predicted Secondary Structure CCCCCCCCCCCCCCEEEEEEECCCCCEEEEEECCCCEEEEECCCCEEEEEEECCCCEEEEEEECCCCCEE...
Protein Variant
LocationDescription
6P -> A (in dbSNP:rs1471615). VAR_060327
169R -> K (in dbSNP:rs7215209). VAR_060328
319Q -> K (in a breast cancer sample;somatic mutation).
406Y -> H (in dbSNP:rs2306513). VAR_057616
434S -> N (in dbSNP:rs2306512). VAR_057617
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAAAVP
---CCCCCC
12.25UniProtKB
Link-
40PhosphothreoninePVDITPDRL
CEEEEECCC
18.05HPRD
Link-
40PhosphothreoninePVDITPDRL
CEEEEECCC
18.05Phosphositeplus
Link-
79PhosphoserineKTLESQAVE
CCEEEEECC
26.93HPRD
Link-
79PhosphoserineKTLESQAVE
CCEEEEECC
26.93PhosphoELM
Link-
79PhosphoserineKTLESQAVE
CCEEEEECC
26.93Phosphositeplus
Link-
79Phosphoserine.KTLESQAVE
CCEEEEECC
26.93UniProtKB
Link-
128PhosphotyrosinePTGKYLASG
CCCCEEEEE
14.62HPRD
Link-
128PhosphotyrosinePTGKYLASG
CCCCEEEEE
14.62Phosphositeplus
Link-
131PhosphoserineKYLASGSGD
CEEEEECCC
30.78HPRD
Link-
133PhosphoserineLASGSGDTT
EEEECCCCE
30.88HPRD
Link-
136PhosphothreonineGSGDTTVRF
ECCCCEEEE
30.62HPRD
Link-
137PhosphothreonineSGDTTVRFW
CCCCEEEEE
17.90HPRD
Link-
224Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ASSSKDGSV
EEEECCCEE
68.97Phosphositeplus
Link-
246PhosphothreonineLTGHTQSVT
EECCCCEEE
24.72HPRD
Link-
326Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LQELKERAL
EEEEECCCC
44.39Phosphositeplus
Link-
381PhosphoserineQVLFSPDSR
EEEECCCCC
24.52HPRD
Link-
384PhosphoserineFSPDSRIVA
ECCCCCEEE
27.56HPRD
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
Phosphorylation
ReferencePubMed
"ATM and ATR substrate analysis reveals extensive protein networksresponsive to DNA damage.";
Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III,Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N.,Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J.;
Science 316:1160-1166(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-79, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures