Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Nicotinamide N-methyltransferase  

UniProtKB / Swiss-Prot ID :  NNMT_HUMAN

Gene Name (Synonyms) : 
NNMT  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  Catalyzes the N-methylation of nicotinamide and other pyridines to form pyridinium ions. This activity is important for biotransformation of many drugs and xenobiotic compounds. 

Protein Sequence MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQ...
Predicted Secondary Structure CCCCCCCHHHHHHHCCHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
11PhosphotyrosineSKDTYLSHF
CHHHHHHHC
19.15Phosphositeplus
Link
39N6-acetyllysineSQILKHLLK
HHHHHHHHH
33.56HPRD
Link
39N6-acetyllysineSQILKHLLK
HHHHHHHHH
33.56Phosphositeplus
Link
39N6-acetyllysine.SQILKHLLK
HHHHHHHHH
33.56UniProtKB
Link
113PhosphotyrosinePVVTYVCDL
HHHHHHHHC
6.35Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
NAMPT_HUMANENSP00000299964STRING
CD38_HUMANENSP00000299964STRING
ADO_HUMANENSP00000299964STRING
BST1_HUMANENSP00000299964STRING
PNPH_HUMANENSP00000299964STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
DrugBank
DB00627Niacin
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-39, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures