Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Polynucleotide 5'-hydroxyl-kinase NOL9  

UniProtKB / Swiss-Prot ID :  NOL9_HUMAN

Gene Name (Synonyms) : 
NOL9  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Nucleus, nucleolus. Note=Colocalizes with pre-60S rRNPs particles. 

Protein Function :  Polynucleotide 5'-kinase involved in rRNA processing. The kinase activity is required for the processing of the 32S precursor into 5.8S and 28S rRNAs, more specifically for the generation of the major 5.8S(S) form. In vitro, has both DNA and RNA 5'-kinase activities. Probably binds RNA. 

Protein Sequence MADSGLLLKRGSCRSTWLRVRKARPQLILSRRPRRRLGSLRWCGRRRLRWRLLQAQASGVDWREGARQVS...
Predicted Secondary Structure CCCCCEEEECCCCCHHHHEEECCCCCEEECCCCHHHHCCCHHHCCHHHHHEEEHHHCCCCCHHHHHHHHH...
Protein Variant
LocationDescription
10R -> W (in dbSNP:rs4908923). VAR_054777
50W -> R (in dbSNP:rs6693400). VAR_054778
58S -> A (in dbSNP:rs6693391). VAR_054779
420I -> V (in dbSNP:rs17029613). VAR_056955
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MADSGL
---CCCCCE
21.48UniProtKB
Link-
395PhosphoserineKYVFSAYKR
HHHHHHHHH
22.20HPRD
Link-
395PhosphoserineKYVFSAYKR
HHHHHHHHH
22.20Phosphositeplus
Link-
397PhosphotyrosineVFSAYKRES
HHHHHHHHC
14.91HPRD
Link-
397PhosphotyrosineVFSAYKRES
HHHHHHHHC
14.91Phosphositeplus
Link-
440Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SDHSKYMPD
CCCCHHCCC
41.99Phosphositeplus
Link-
459Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GLYTKSKTK
CHHHHHHCC
36.08Phosphositeplus
Link-
487PhosphoserineEEKESPVEF
CCCCCCCCC
45.36HPRD
Link-
487PhosphoserineEEKESPVEF
CCCCCCCCC
45.36Phosphositeplus
Link-
492PhosphothreoninePVEFTGHKL
CCCCCCCCH
25.52Phosphositeplus
Link-
670Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DYNFKLPGA
CCCEECCCC
50.57Phosphositeplus
Link-
677Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GASEKIGAR
CCHHHHHCC
43.90Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures