Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Nitric oxide synthase, endothelial  

UniProtKB / Swiss-Prot ID :  NOS3_BOVIN

Gene Name (Synonyms) : 
NOS3  

Species :  Bos taurus (Bovine). 

Subcellular Localization :  Cell membrane. Membrane, caveola. Cytoplasm, cytoskeleton (By similarity). Golgi apparatus. Note=Specifically associates with actin cytoskeleton in the G2 phase of the cell cycle; which is favored by interaction with NOSIP and results in a reduced enzyma 

Protein Function :  Produces nitric oxide (NO) which is implicated in vascular smooth muscle relaxation through a cGMP-mediated signal transduction pathway. NO mediates vascular endothelial growth factor (VEGF)-induced angiogenesis in coronary vessels and promotes blood clotting through the activation of platelets. 

Protein Sequence MGNLKSVGQEPGPPCGLGLGLGLGLCGKQGPASPAPEPSRAPAPATPHAPDHSPAPNSPTLTRPPEGPKF...
Predicted Secondary Structure CCCHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-myristoyl glycine.---MGNLKS
---CCCHHH
60.53UniProtKB
Link-
15S-palmitoyl cysteine.PGPPCGLGL
CCCCCCCCC
8.71UniProtKB
Link-
26S-palmitoyl cysteine.GLGLCGKQG
CCCCCCCCC
6.41UniProtKB
Link-
83PhosphotyrosineGSITYDTLC
CCEEEEEEE
12.78Phosphositeplus
Link
83Phosphotyrosine (SRC)GSITYDTLC
CCEEEEEEE
12.78PhosphoELM
Link
116PhosphoserineQTRPSPGPP
CCCCCCCCC
38.92PhosphoELM
Link
116PhosphoserineQTRPSPGPP
CCCCCCCCC
38.92Phosphositeplus
Link
143Phosphoserine; by PKA.SIKRSGSQA
HHCCCCCHH
37.48UniProtKB
Link
497PhosphothreonineTRKKTFKEV
CCCCCCCCC
42.87Phosphositeplus
Link-
497Phosphothreonine (PKC_alpha)TRKKTFKEV
CCCCCCCCC
42.87PhosphoELM
Link-
497Phosphothreonine; by AMPK and PKA.TRKKTFKEV
CCCCCCCCC
42.87UniProtKB
Link-
617PhosphoserineIRFNSVSCS
CCCCCCCCC
16.82PhosphoELM
Link-
617PhosphoserineIRFNSVSCS
CCCCCCCCC
16.82Phosphositeplus
Link-
635PhosphoserineKRKESSNTD
CCCCCCCCC
31.74PhosphoELM
Link-
635PhosphoserineKRKESSNTD
CCCCCCCCC
31.74Phosphositeplus
Link-
635Phosphoserine.KRKESSNTD
CCCCCCCCC
31.74UniProtKB
Link-
1177PhosphothreonineSRIRTQSFS
HHHHHHHHH
26.62Phosphositeplus
Link-
1179PhosphoserineIRTQSFSLQ
HHHHHHHHH
19.05Phosphositeplus
Link-
1179Phosphoserine (AMPK_group)IRTQSFSLQ
HHHHHHHHH
19.05PhosphoELM
Link-
1179Phosphoserine; by AMPK, PDPK1 and PKA.IRTQSFSLQ
HHHHHHHHH
19.05UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Myristoylation
ReferencePubMed
"Endothelial nitric oxide synthase. N-terminal myristoylationdetermines subcellular localization.";
Busconi L., Michel T.;
J. Biol. Chem. 268:8410-8413(1993).
Cited for: MYRISTOYLATION AT GLY-2.
Palmitoylation
ReferencePubMed
"Mutagenesis of palmitoylation sites in endothelial nitric oxidesynthase identifies a novel motif for dual acylation and subcellulartargeting.";
Robinson L.J., Michel T.;
Proc. Natl. Acad. Sci. U.S.A. 92:11776-11780(1995).
Cited for: PALMITOYLATION AT CYS-15 AND CYS-26.
Phosphorylation
ReferencePubMed
"Shear stress stimulates phosphorylation of eNOS at Ser(635) by aprotein kinase A-dependent mechanism.";
Boo Y.C., Hwang J., Sykes M., Michell B.J., Kemp B.E., Lum H., Jo H.;
Am. J. Physiol. 283:H1819-H1828(2002).
Cited for: PHOSPHORYLATION AT THR-497; SER-635 AND SER-1179.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures