Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Nuclear protein localization protein 4 homolog  

UniProtKB / Swiss-Prot ID :  NPL4_MOUSE

Gene Name (Synonyms) : 
Nploc4, Kiaa1499, Npl4  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Cytoplasm, cytosol (By similarity). Endoplasmic reticulum (By similarity). Nucleus (By similarity). Note=Associated with the endoplasmic reticulum and nuclear (By similarity). 

Protein Function :  The ternary complex containing UFD1L, VCP and NPLOC4 binds ubiquitinated proteins and is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome. The NPLOC4-UFD1L-VCP complex regulates spindle disassembly at the end of mitosis and is necessary for the formation of a closed nuclear envelope (By similarity). 

Protein Sequence MAESIIIRVQSPDGVKRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNKTGEITASSSKSLHLLKIK...
Predicted Secondary Structure CCCEEEEEEECCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCEEHHCCCCEEHHCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
188S-nitrosocysteineENISCKIKS
CCCCEEECC
4.71dbSNO
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures