Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Ribosyldihydronicotinamide dehydrogenase [quinone]  

UniProtKB / Swiss-Prot ID :  NQO2_HUMAN

Gene Name (Synonyms) : 
NQO2, NMOR2  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinones involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis. 

Protein Sequence MAGKKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNLEPRATDKDITGTLSNPEVFNYGV...
Predicted Secondary Structure CCCCEEEEEEECCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCEECHHHHHHHHCCHHHCCCCC...
Protein Variant
LocationDescription
16K -> R (in dbSNP:rs28383623). VAR_021399
29E -> G (in dbSNP:rs17136117). VAR_021400
47L -> F (in dbSNP:rs1143684). VAR_021401
58G -> D (in dbSNP:rs17300141). VAR_021402
184V -> A (in dbSNP:rs28383651). VAR_021403
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
16Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)HQEPKSFNG
CCCCCHHHH
67.91Phosphositeplus
Link
23Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)NGSLKNVAV
HHHHHHHHH
51.58Phosphositeplus
Link
31PhosphoserineVDELSRQGC
HHHHHCCCC
22.10HPRD
Link
31PhosphoserineVDELSRQGC
HHHHHCCCC
22.10Phosphositeplus
Link
31Phosphoserine.VDELSRQGC
HHHHHCCCC
22.10UniProtKB
Link
54Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)RATDKDITG
EECHHHHHH
46.83Phosphositeplus
Link
77Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)HEAYKQRSL
HHHHHHHHH
46.40Phosphositeplus
Link
80PhosphoserineYKQRSLASD
HHHHHHHHH
26.29Phosphositeplus
Link
80Phosphoserine.YKQRSLASD
HHHHHHHHH
26.29UniProtKB
Link
90Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TDEQKKVRE
HHHHHHHHH
51.71Phosphositeplus
Link
133PhosphotyrosineIPGFYDSGL
CCCCCCCCC
18.34HPRD
Link
133PhosphotyrosineIPGFYDSGL
CCCCCCCCC
18.34Phosphositeplus
Link
135PhosphoserineGFYDSGLLQ
CCCCCCCCC
21.69HPRD
Link
135PhosphoserineGFYDSGLLQ
CCCCCCCCC
21.69Phosphositeplus
Link
148PhosphothreonineLLSVTTGGT
EEEEEECCC
19.15HPRD
Link
156PhosphotyrosineTAEMYTKTG
CCCCCCCCC
9.15HPRD
Link
158Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EMYTKTGVN
CCCCCCCCC
26.29Phosphositeplus
Link
197PhosphoserinePEIASEEER
CCCCCHHHH
51.72Phosphositeplus
Link
197Phosphoserine.PEIASEEER
CCCCCHHHH
51.72UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
RELB_HUMANphysical interactionMINT-49032MINT14743216
GORS2_HUMANphysical interactionEBI-759316
intact16189514
GORS2_HUMANyeast 2-hybridHPRD:01190HPRD16189514
NQO2_HUMANin vitroHPRD:01190HPRD10433694
9050836
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
DrugBank
DB06695Dabigatran etexilate
DB03147Flavin adenine dinucleotide
DB01065Melatonin
DB00170Menadione
DB01087Primaquine
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Kinase-selective enrichment enables quantitative phosphoproteomics ofthe kinome across the cell cycle.";
Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R.,Greff Z., Keri G., Stemmann O., Mann M.;
Mol. Cell 31:438-448(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-31, AND MASSSPECTROMETRY.
"Large-scale proteomics analysis of the human kinome.";
Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G.,Mann M., Daub H.;
Mol. Cell. Proteomics 8:1751-1764(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-80 AND SER-197, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures