Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Neuraminidase  

UniProtKB / Swiss-Prot ID :  NRAM_I56A2

Gene Name (Synonyms) : 
NA  

Species :  Influenza A virus (strain A/Duck/England/1/1956 H11N6). 

Subcellular Localization :  Virion membrane (By similarity). Host apical cell membrane; Single-pass type II membrane protein (By similarity). Note=Preferentially accumulates at the apical plasma membrane in infected polarized epithelial cells, which is the virus assembly site. Uses 

Protein Function :  Catalyzes the removal of terminal sialic acid residues from viral and cellular glycoconjugates. Cleaves off the terminal sialic acids on the glycosylated HA during virus budding to facilitate virus release. Additionally helps virus spread through the circulation by further removing sialic acids from the cell surface. These cleavages prevent self-aggregation and ensure the efficient spread of the progeny virus from cell to cell. Otherwise, infection would be limited to one round of replication. Described as a receptor-destroying enzyme because it cleaves a terminal sialic acid from the cellular receptors. May facilitate viral invasion of the upper airways by cleaving the sialic acid moities on the mucin of the airway epithelial cells. Likely to plays a role in the budding process through its association with lipid rafts during intracellular transport. May additionally display a raft-association independent effect on budding. Plays a role in the determination of host range restriction on replication and virulence. Sialidase activity in late endosome/lysosome traffic seems to enhance virus replication. 

Transmembrane Topology (topPTM) : NRAM_I56A2 

Protein Sequence MNPNQKIICISATGMTLSVVSLLVGIANLGLNIGLHYKVGDTPNVNIPNVNGTNSTTTIINNNTQNNFTN...
Predicted Secondary Structure  -
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
51N-linked (GlcNAc...); by hostIPNVNGTNS
59.20UniProtKB
Link-
54N-linked (GlcNAc...); by hostVNGTNSTTT
38.46UniProtKB
Link-
62N-linked (GlcNAc...); by hostTIINNNTQN
42.38UniProtKB
Link-
67N-linked (GlcNAc...); by hostNTQNNFTNI
34.99UniProtKB
Link-
70N-linked (GlcNAc...); by hostNNFTNITNI
34.64UniProtKB
Link-
86N-linked (GlcNAc...); by hostRTFLNLTKP
41.28UniProtKB
Link
146N-linked (GlcNAc...); by hostGRHANGTIH
41.85UniProtKB
Link
201N-linked (GlcNAc...); by hostGPNNNASAV
41.74UniProtKB
Link
402N-linked (GlcNAc...); by hostVNNQNWSGY
36.68UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures