Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Putative methyltransferase NSUN4  

UniProtKB / Swiss-Prot ID :  NSUN4_HUMAN

Gene Name (Synonyms) : 
NSUN4  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  May have S-adenosyl-L-methionine-dependent methyl- transferase activity (Potential). 

Protein Sequence MAALTLRGVRELLKRVDLATVPRRHRYKKKWAATEPKFPAVRLALQNFDMTYSVQFGDLWPSIRVSLLSE...
Predicted Secondary Structure CCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHCCC...
Protein Variant
LocationDescription
51T -> A (in dbSNP:rs3737744). VAR_032606
128N -> K (in dbSNP:rs17102152). VAR_032607
325I -> T (in dbSNP:rs13374337). VAR_032608
365I -> V (in dbSNP:rs9865). VAR_032609
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
37Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ATEPKFPAV
CCCCHHHHH
58.72Phosphositeplus
Link-
206PhosphoserineANDLSPSRI
EEECCHHHH
24.56HPRD
Link
206PhosphoserineANDLSPSRI
EEECCHHHH
24.56PhosphoELM
Link
206PhosphoserineANDLSPSRI
EEECCHHHH
24.56Phosphositeplus
Link
215Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ARLQKILHS
HHHHHHHHH
52.40Phosphositeplus
Link
219PhosphoserineKILHSYVPE
HHHHHHHHH
25.12Phosphositeplus
Link
220PhosphotyrosineILHSYVPEE
HHHHHHHHH
14.85Phosphositeplus
Link
240Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)WDGRKWGEL
CCCCCCCCC
66.15Phosphositeplus
Link
274Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)NNIFKRSRK
HHHHHCCCH
45.74Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
MAGAB_HUMANphysical interactionMINT-67878MINT16189514
Q9BWA2_HUMANphysical interactionMINT-66503MINT16189514
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures