Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  5'(3')-deoxyribonucleotidase, cytosolic type  

UniProtKB / Swiss-Prot ID :  NT5C_MOUSE

Gene Name (Synonyms) : 
Nt5c, Dnt1  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  Dephosphorylates the 5' and 2'(3')-phosphates of deoxyribonucleotides, with a preference for dUMP and dTMP, intermediate activity towards dGMP, and low activity towards dCMP and dAMP. 

Protein Sequence MAVKRPVRVLVDMDGVLADFESGLLQGFRRRFPEEPHVPLEQRRGFLANEQYGALRPDLAEKVASVYESP...
Predicted Secondary Structure CCCCCCEEEEEEHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHCCCCCHHHHHHHCCCHHHHHHHHHHCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
102PhosphothreonineFICTTPLLK
EEEECCCCC
13.92Phosphositeplus
Link
184PhosphoserineRRLLSWSDN
HHHCCHHHH
29.17Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures