Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Ornithine aminotransferase, mitochondrial  

UniProtKB / Swiss-Prot ID :  OAT_HUMAN

Gene Name (Synonyms) : 
OAT  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Mitochondrion matrix. 

Protein Function :   

Protein Sequence MFSKLAHLQRFAVLSRGVHSSVASATSVATKKTVQGPPTSDDIFEREYKYGAHNYHPLPVALERGKGIYL...
Predicted Secondary Structure CCCCHHHHHCCCCCCCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCEEEEECCCCEE...
Protein Variant
LocationDescription
54N -> K (in HOGA). VAR_000565
55Y -> H (in HOGA). VAR_000566
89N -> K (in HOGA). VAR_000567
90Q -> E (in HOGA; mistargeted, accumulatesin cytoplasm).
93C -> F (in HOGA). VAR_000568
154R -> L (in HOGA; complete loss ofactivity).
180R -> T (in HOGA; complete loss ofactivity).
184Missing (in HOGA). VAR_000571
226A -> V (in HOGA). VAR_000572
241P -> L (in HOGA). VAR_000573
245Y -> C (in HOGA). VAR_000574
250R -> P (in HOGA). VAR_000575
267T -> I (in HOGA). VAR_000576
270A -> P (in HOGA). VAR_000577
271R -> K (in HOGA). VAR_000578
319H -> Y (in HOGA). VAR_000579
332V -> M (in HOGA). VAR_000580
353G -> D (in HOGA). VAR_000581
375G -> A (in HOGA). VAR_000582
394C -> R (in HOGA). VAR_000583
402L -> P (in HOGA). VAR_000584
417P -> L (in HOGA). VAR_000585
437L -> F (in dbSNP:rs1800456). VAR_000586
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
32Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VATKKTVQG
CCCCCCCCC
49.96Phosphositeplus
Link-
49Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EREYKYGAH
HHHHHCCCC
32.24Phosphositeplus
Link
66Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LERGKGIYL
EEECCCCEE
48.64Phosphositeplus
Link
272PhosphothreonineGLARTGRWL
CHHHHHHCC
26.03HPRD
Link
272PhosphothreonineGLARTGRWL
CHHHHHHCC
26.03Phosphositeplus
Link
292N6-(pyridoxal phosphate)lysine.VLLGKALSG
HHHHHHHHH
46.23UniProtKB
Link
362Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)NELMKLPSD
HHHHHHHHC
70.62Phosphositeplus
Link
369PhosphothreonineSDVVTAVRG
HCCCCEEEC
21.20HPRD
Link
374Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AVRGKGLLN
EEECCEEEE
35.50Phosphositeplus
Link
392Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)WDAWKVCLR
CHHHHHHHH
25.45Phosphositeplus
Link
405Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GLLAKPTHG
CEEEECCCC
50.87Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
UBQL4_HUMANphysical interactionMINT-2861399MINT16713569
CB018_HUMANphysical interactionEBI-735271
intact16169070
OAT_HUMANin vitroHPRD:02021HPRD2363680
7932736
9309222
9514741
9878407
UBQL4_HUMANyeast 2-hybridHPRD:02021HPRD16713569
CB018_HUMANyeast 2-hybridHPRD:02021HPRD16169070
- top -

Disease Reference
Kegg disease
OMIM disease
258870Hyperornithinemia with gyrate atrophy of choroid and retina (HOGA)
Drug Reference
DrugBank
DB00129L-Ornithine
- top -
Related Literatures of Post-Translational Modification
Pyridoxal phosphate
ReferencePubMed
"The primary structure of ornithine aminotransferase. Identificationof active-site sequence and site of post-translational proteolysis.";
Simmaco M., John R.A., Barra D., Bossa F.;
FEBS Lett. 199:39-42(1986).
Cited for: PARTIAL PROTEIN SEQUENCE, PYRIDOXAL PHOSPHATE AT LYS-292, ANDPROTEOLYTIC PROCESSING.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures