Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Odorant-binding protein  

UniProtKB / Swiss-Prot ID :  OBP_PIG

Gene Name (Synonyms) :  -
 

Species :  Sus scrofa (Pig). 

Subcellular Localization :  Secreted. 

Protein Function :  This protein is found in nasal epithelium and it binds a wide variety of chemical odorants. 

Protein Sequence QEPQPEQDPFELSGKWITSYIGSSDLEKIGENAPFQVFMRSIEFDDKESKVYLNFFSKENGICEEFSLIG...
Predicted Secondary Structure CCCCCCCCHHHHCCEEEEEEEEECCHHHHCCCCCEEEEEEEEEECCCCCEEEEEEEEEECCEEEEEEEEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
1Pyrrolidone carboxylic acid.----QEPQP
----CCCCC
80.52UniProtKB
Link-
13PhosphoserinePFELSGKWI
HHHHCCEEE
31.00Phosphositeplus
Link
23PhosphoserineSYIGSSDLE
EEEEECCHH
15.89Phosphositeplus
Link
24PhosphoserineYIGSSDLEK
EEEECCHHH
40.79Phosphositeplus
Link
41PhosphoserineVFMRSIEFD
EEEEEEEEC
18.06Phosphositeplus
Link
49PhosphoserineDDKESKVYL
CCCCCEEEE
32.91Phosphositeplus
Link
52PhosphotyrosineESKVYLNFF
CCEEEEEEE
10.32Phosphositeplus
Link
57PhosphoserineLNFFSKENG
EEEEEEECC
34.62Phosphositeplus
Link
67PhosphoserineCEEFSLIGT
EEEEEEEEE
23.51Phosphositeplus
Link
71PhosphothreonineSLIGTKQEG
EEEEEECCC
23.66Phosphositeplus
Link
82PhosphotyrosineYDVNYAGNN
EEEEECCEE
18.74Phosphositeplus
Link
112PhosphothreonineEGDKTIMTG
CCCEEEEEE
22.26Phosphositeplus
Link
115PhosphothreonineKTIMTGLLG
EEEEEEEEE
22.34Phosphositeplus
Link
122PhosphothreonineLGKGTDIED
EECCCCCCH
36.97Phosphositeplus
Link
136PhosphothreonineFKEVTRENG
HHHHHHHCC
33.10Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures