Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Oxysterol-binding protein-related protein 9  

UniProtKB / Swiss-Prot ID :  OSBL9_HUMAN

Gene Name (Synonyms) : 
OSBPL9, ORP9, OSBP4  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :   

Protein Sequence MASIMEGPLSKWTNVMKGWQYRWFVLDYNAGLLSYYTSKDKMMRGSRRGCVRLRGAVIGIDDEDDSTFTI...
Predicted Secondary Structure CCCCEEEEEEECCCCCCCCEEEEEEEECCCCEEEEECCCHHHHCCCCCCEEEEEEEEEEECCCCCCEEEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MASIME
---CCCCEE
14.04UniProtKB
Link-
238PhosphoserineQRPSSLPVG
CCCCCCCCC
39.10HPRD
Link-
287PhosphoserineVPEFSYSSS
CCCCCCHHH
23.57Phosphositeplus
Link-
329PhosphoserineSSGNSLKRP
CCCCCCCCC
38.50HPRD
Link-
329PhosphoserineSSGNSLKRP
CCCCCCCCC
38.50Phosphositeplus
Link-
344PhosphoserineNSSLSNGTS
CCCEECCCC
34.85HPRD
Link-
344PhosphoserineNSSLSNGTS
CCCEECCCC
34.85SysPTM
Link-
348PhosphoserineSNGTSDADL
ECCCCCCCC
32.00HPRD
Link-
348PhosphoserineSNGTSDADL
ECCCCCCCC
32.00SysPTM
Link-
670Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)RSLWKDVTF
CCCCCCCCC
47.84Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures