Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Cellular tumor antigen p53  

UniProtKB / Swiss-Prot ID :  P53_HUMAN

Gene Name (Synonyms) : 
TP53, P53  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. Nucleus. Nucleus, PML body. Endoplasmic reticulum. Note=Interaction with BANP promotes nuclear localization. Recruited into PML bodies together with CHEK2. Isoform 1: Nucleus. Cytoplasm. Note=Predominantly nuclear but localizes to the cytoplas 

Protein Function :  Acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. One of the activated genes is an inhibitor of cyclin-dependent kinases. Apoptosis induction seems to be mediated either by stimulation of BAX and FAS antigen expression, or by repression of Bcl-2 expression. Implicated in Notch signaling cross-over. Prevents CDK7 kinase activity when associated to CAK complex in response to DNA damage, thus stopping cell cycle progression. Isoform 2 enhances the transactivation activity of isoform 1 from some but not all TP53-inducible promoters. Isoform 4 suppresses transactivation activity and impairs growth suppression mediated by isoform 1. Isoform 7 inhibits isoform 1-mediated apoptosis. 

Protein Sequence MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAA...
Predicted Secondary Structure CCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCHHHHHCCCHHHHHHHCCCCCCCCCCCCCCCC...
Protein Variant
LocationDescription
5Q -> H (in a sporadic cancer; somaticmutation; abolishes strongly
6S -> L (in a sporadic cancer; somaticmutation).
7D -> H (in a sporadic cancer; somaticmutation).
8P -> S (in a sporadic cancer; somaticmutation).
10V -> I (in a sporadic cancer; somaticmutation).
11E -> K (in sporadic cancers; somaticmutation).
11E -> Q (in sporadic cancers; somaticmutation).
15S -> R (in a sporadic cancer; somaticmutation).
16Q -> L (in a sporadic cancer; somaticmutation).
17E -> D (in a sporadic cancer; somaticmutation).
24K -> N (in a sporadic cancer; somaticmutation).
28E -> A (in a sporadic cancer; somaticmutation).
29NN -> KD (in a sporadic cancer; somaticmutation).
31V -> I (in sporadic cancers; somaticmutation).
33S -> T (in a sporadic cancer; somaticmutation).
34P -> L (in a sporadic cancer; somaticmutation).
35L -> F (in sporadic cancers; somaticmutation).
36P -> L (in a sporadic cancer; somaticmutation).
37S -> P (in a sporadic cancer; somaticmutation).
37S -> T (in a sporadic cancer; somaticmutation).
39A -> P (in a sporadic cancer; somaticmutation).
39A -> V (in a sporadic cancer; somaticmutation).
42D -> Y (in a sporadic cancer; somaticmutation).
43L -> S (in a sporadic cancer; somaticmutation).
44M -> I (in a sporadic cancer; somaticmutation).
44M -> T (in a sporadic cancer; somaticmutation).
44M -> V (in a sporadic cancer; somaticmutation).
45L -> M (in a sporadic cancer; somaticmutation).
46S -> F (in sporadic cancers; somaticmutation).
46S -> P (in sporadic cancers; somaticmutation).
47P -> L (in sporadic cancers; somaticmutation).
47P -> S (in dbSNP:rs1800371). VAR_014632
48D -> G (in a sporadic cancer; somaticmutation).
49D -> H (in sporadic cancers; somaticmutation).
49D -> N (in a sporadic cancer; somaticmutation).
49D -> Y (in sporadic cancers; somaticmutation).
52Q -> H (in a sporadic cancer; somaticmutation).
53W -> C (in sporadic cancers; somaticmutation).
53W -> G (in a sporadic cancer; somaticmutation).
54F -> L (in a sporadic cancer; somaticmutation).
54F -> Y (in a sporadic cancer; somaticmutation).
56E -> K (in sporadic cancers; somaticmutation).
56E -> V (in a sporadic cancer; somaticmutation).
58P -> Q (in a sporadic cancer; somaticmutation).
58P -> T (in a sporadic cancer; somaticmutation).
59G -> C (in sporadic cancers; somaticmutation).
59G -> D (in sporadic cancers; somaticmutation).
59G -> N (in a sporadic cancer; somaticmutation; requires 2 nucleotide
60P -> L (in sporadic cancers; somaticmutation).
60P -> Q (in a sporadic cancer; somaticmutation).
60P -> S (in a sporadic cancer; somaticmutation).
61D -> G (in sporadic cancers; somaticmutation).
61D -> N (in sporadic cancers; somaticmutation).
62E -> D (in a sporadic cancer; somaticmutation).
63A -> T (in a sporadic cancer; somaticmutation).
63A -> V (in a sporadic cancer; somaticmutation).
65R -> T (in a sporadic cancer; somaticmutation).
66M -> I (in a sporadic cancer; somaticmutation).
66M -> R (in a sporadic cancer; somaticmutation).
67P -> L (in sporadic cancers; somaticmutation).
67P -> R (in a sporadic cancer; somaticmutation).
67P -> S (in sporadic cancers; somaticmutation).
68E -> G (in sporadic cancers; somaticmutation).
68E -> Q (in a sporadic cancer; somaticmutation).
69A -> D (in a sporadic cancer; somaticmutation).
69A -> G (in sporadic cancers; somaticmutation).
69A -> T (in a sporadic cancer; somaticmutation).
69A -> V (in a sporadic cancer; somaticmutation).
70A -> T (in a sporadic cancer; somaticmutation).
71P -> T (in a sporadic cancer; somaticmutation).
72P -> C (in sporadic cancers; somaticmutation; requires 2 nucleotide
72P -> G (in sporadic cancers; somaticmutation; requires 2 nucleotide
72P -> H (in sporadic cancers; somaticmutation).
72P -> L (in a sporadic cancer; somaticmutation).
72P -> R (in dbSNP:rs1042522). VAR_005856
73V -> E (in a sporadic cancer; somaticmutation).
73V -> L (in sporadic cancers; somaticmutation).
73V -> M (in sporadic cancers; somaticmutation).
74A -> T (in a sporadic cancer; somaticmutation).
75P -> L (in sporadic cancers; somaticmutation).
75P -> R (in sporadic cancers; somaticmutation).
75P -> S (in a sporadic cancer; somaticmutation).
76A -> G (in a sporadic cancer; somaticmutation).
76A -> T (in a sporadic cancer; somaticmutation).
77P -> A (in sporadic cancers; somaticmutation).
78A -> V (in sporadic cancers; somaticmutation).
79A -> G (in a sporadic cancer; somaticmutation).
79A -> T (in a sporadic cancer; somaticmutation).
79A -> V (in sporadic cancers; somaticmutation).
80P -> L (in a sporadic cancer; somaticmutation).
80P -> S (in a sporadic cancer; somaticmutation).
81T -> I (in sporadic cancers; somaticmutation).
82P -> L (in LFS; germline mutation and insporadic cancers; somatic mutation).
82P -> S (in sporadic cancers; somaticmutation).
83A -> E (in a sporadic cancer; somaticmutation).
83A -> V (in sporadic cancers; somaticmutation).
84A -> G (in sporadic cancers; somaticmutation).
84A -> V (in sporadic cancers; somaticmutation).
85P -> L (in sporadic cancers; somaticmutation).
85P -> S (in sporadic cancers; somaticmutation).
86A -> V (in a sporadic cancer; somaticmutation).
87P -> Q (in sporadic cancers; somaticmutation).
88A -> T (in a sporadic cancer; somaticmutation).
88A -> V (in sporadic cancers; somaticmutation).
89P -> L (in sporadic cancers; somaticmutation).
89P -> S (in sporadic cancers; somaticmutation).
90S -> F (in sporadic cancers; somaticmutation).
90S -> Y (in a sporadic cancer; somaticmutation).
91W -> C (in a sporadic cancer; somaticmutation).
92P -> A (in a sporadic cancer; somaticmutation).
92P -> L (in a sporadic cancer; somaticmutation).
92P -> S (in a sporadic cancer; somaticmutation).
93L -> M (in a sporadic cancer; somaticmutation).
93L -> P (in a sporadic cancer; somaticmutation).
94S -> L (in sporadic cancers; somaticmutation).
94S -> T (in sporadic cancers; somaticmutation).
95S -> F (in sporadic cancers; somaticmutation).
95S -> T (in a sporadic cancer; somaticmutation).
96S -> C (in a sporadic cancer; somaticmutation).
96S -> F (in sporadic cancers; somaticmutation).
96S -> P (in a sporadic cancer; somaticmutation).
97V -> A (in a sporadic cancer; somaticmutation).
97V -> F (in a sporadic cancer; somaticmutation).
97V -> I (in familial cancer not matchingLFS; germline mutation and in a sporadic
98P -> L (in sporadic cancers; somaticmutation).
98P -> S (in sporadic cancers; somaticmutation).
99S -> F (in sporadic cancers; somaticmutation).
99S -> P (in a sporadic cancer; somaticmutation).
100Q -> R (in a sporadic cancer; somaticmutation).
101K -> N (in a sporadic cancer; somaticmutation).
101K -> R (in sporadic cancers; somaticmutation).
102T -> I (in sporadic cancers; somaticmutation).
104Q -> H (in sporadic cancers; somaticmutation).
104Q -> L (in a sporadic cancer; somaticmutation).
105G -> C (in LFS; germline mutation and insporadic cancers; somatic mutation).
105G -> D (in sporadic cancers; somaticmutation).
105G -> R (in sporadic cancers; somaticmutation).
105G -> S (in a sporadic cancer; somaticmutation).
105G -> V (in sporadic cancers; somaticmutation).
106S -> G (in a sporadic cancer; somaticmutation).
106S -> R (in a familial cancer not matchingLFS; germline mutation and in sporadic
107Y -> C (in a sporadic cancer; somaticmutation).
107Y -> D (in sporadic cancers; somaticmutation).
107Y -> H (in a sporadic cancer; somaticmutation).
108G -> D (in a sporadic cancer; somaticmutation).
108G -> S (in sporadic cancers; somaticmutation).
109F -> C (in sporadic cancers; somaticmutation).
109F -> L (in a sporadic cancer; somaticmutation).
109F -> S (in sporadic cancers; somaticmutation).
110R -> C (in sporadic cancers; somaticmutation).
110R -> G (in a sporadic cancer; somaticmutation).
110R -> H (in sporadic cancers; somaticmutation).
110R -> L (in a familial cancer not matchingLFS; germline mutation and in sporadic
110R -> P (in sporadic cancers; somaticmutation; dbSNP:rs11540654).
110R -> S (in a sporadic cancer; somaticmutation).
111L -> M (in a sporadic cancer; somaticmutation).
111L -> P (in sporadic cancers; somaticmutation).
111L -> Q (in sporadic cancers; somaticmutation).
111L -> R (in sporadic cancers; somaticmutation).
112G -> D (in sporadic cancers; somaticmutation).
112G -> S (in sporadic cancers; somaticmutation).
113F -> C (in sporadic cancers; somaticmutation).
113F -> G (in a sporadic cancer; somaticmutation; requires 2 nucleotide
113F -> I (in a sporadic cancer; somaticmutation).
113F -> L (in sporadic cancers; somaticmutation).
113F -> S (in sporadic cancers; somaticmutation).
113F -> V (in sporadic cancers; somaticmutation).
115H -> Y (in sporadic cancers; somaticmutation).
116S -> C (in sporadic cancers; somaticmutation).
116S -> F (in a sporadic cancer; somaticmutation).
116S -> P (in a sporadic cancer; somaticmutation).
117G -> E (in sporadic cancers; somaticmutation).
117G -> R (in sporadic cancers; somaticmutation).
118T -> A (in a sporadic cancer; somaticmutation).
118T -> I (in sporadic cancers; somaticmutation).
118T -> R (in a sporadic cancer; somaticmutation).
119A -> D (in a sporadic cancer; somaticmutation).
119A -> T (in a sporadic cancer; somaticmutation).
120K -> E (in sporadic cancers; somaticmutation).
120K -> M (in sporadic cancers; somaticmutation).
120K -> Q (in a sporadic cancer; somaticmutation).
120K -> R (in sporadic cancers; somaticmutation).
121S -> F (in sporadic cancers; somaticmutation).
122V -> L (in a sporadic cancer; somaticmutation).
123T -> I (in a sporadic cancer; somaticmutation).
123T -> N (in a sporadic cancer; somaticmutation).
124C -> G (in a sporadic cancer; somaticmutation).
124C -> R (in sporadic cancers; somaticmutation).
124C -> S (in sporadic cancers; somaticmutation).
124C -> W (in a sporadic cancer; somaticmutation).
124C -> Y (in a sporadic cancer; somaticmutation).
125T -> A (in a sporadic cancer; somaticmutation).
125T -> K (in sporadic cancers; somaticmutation).
125T -> M (in sporadic cancers; somaticmutation).
125T -> P (in a sporadic cancer; somaticmutation).
125T -> R (in sporadic cancers; somaticmutation).
126Y -> C (in a familial cancer not matchingLFS; germline mutation and in sporadic
126Y -> D (in sporadic cancers; somaticmutation).
126Y -> F (in a sporadic cancer; somaticmutation).
126Y -> G (in a sporadic cancer; somaticmutation; requires 2 nucleotide
126Y -> H (in sporadic cancers; somaticmutation).
126Y -> N (in sporadic cancers; somaticmutation).
126Y -> S (in sporadic cancers; somaticmutation).
127S -> C (in a sporadic cancer; somaticmutation).
127S -> F (in sporadic cancers; somaticmutation).
127S -> P (in sporadic cancers; somaticmutation).
127S -> T (in sporadic cancers; somaticmutation).
127S -> Y (in sporadic cancers; somaticmutation).
128P -> A (in sporadic cancers; somaticmutation).
128P -> L (in sporadic cancers; somaticmutation).
128P -> R (in sporadic cancers; somaticmutation).
128P -> S (in sporadic cancers; somaticmutation).
129A -> D (in sporadic cancers; somaticmutation).
129A -> G (in a sporadic cancer; somaticmutation).
129A -> T (in sporadic cancers; somaticmutation).
129A -> V (in sporadic cancers; somaticmutation).
130L -> F (in sporadic cancers; somaticmutation).
130L -> H (in sporadic cancers; somaticmutation).
130L -> I (in a sporadic cancer; somaticmutation).
130L -> P (in sporadic cancers; somaticmutation).
130L -> R (in sporadic cancers; somaticmutation).
130L -> V (in sporadic cancers; somaticmutation).
131N -> D (in a sporadic cancer; somaticmutation).
131N -> H (in sporadic cancers; somaticmutation).
131N -> I (in sporadic cancers; somaticmutation).
131N -> K (in sporadic cancers; somaticmutation).
131N -> S (in sporadic cancers; somaticmutation).
131N -> T (in a sporadic cancer; somaticmutation).
131N -> Y (in sporadic cancers; somaticmutation).
132KM -> NL (in a sporadic cancer; somaticmutation).
132K -> E (in LFS; germline mutation and insporadic cancers; somatic mutation).
132K -> L (in a sporadic cancer; somaticmutation; requires 2 nucleotide
132K -> M (in sporadic cancers; somaticmutation).
132K -> N (in sporadic cancers; somaticmutation).
132K -> Q (in sporadic cancers; somaticmutation).
132K -> R (in sporadic cancers; somaticmutation).
132K -> T (in sporadic cancers; somaticmutation).
132K -> W (in a sporadic cancer; somaticmutation; requires 2 nucleotide
133M -> I (in sporadic cancers; somaticmutation).
133M -> K (in sporadic cancers; somaticmutation).
133M -> L (in sporadic cancers; somaticmutation).
133M -> R (in LFS; germline mutation and insporadic cancers; somatic mutation).
133M -> T (in LFS; germline mutation and insporadic cancers; somatic mutation;
133M -> V (in sporadic cancers; somaticmutation).
134F -> C (in sporadic cancers; somaticmutation).
134F -> I (in sporadic cancers; somaticmutation).
134F -> L (in sporadic cancers; somaticmutation).
134F -> S (in sporadic cancers; somaticmutation).
134F -> V (in sporadic cancers; somaticmutation).
135C -> F (in sporadic cancers; somaticmutation).
135C -> G (in sporadic cancers; somaticmutation).
135C -> R (in sporadic cancers; somaticmutation).
135C -> S (in sporadic cancers; somaticmutation).
135C -> T (in a sporadic cancer; somaticmutation; requires 2 nucleotide
135C -> W (in sporadic cancers; somaticmutation).
135C -> Y (in sporadic cancers; somaticmutation; decreased E6-mediated binding
136Q -> E (in sporadic cancers; somaticmutation).
136Q -> H (in sporadic cancers; somaticmutation).
136Q -> K (in a sporadic cancer; somaticmutation).
136Q -> P (in sporadic cancers; somaticmutation).
136Q -> R (in sporadic cancers; somaticmutation).
137L -> M (in sporadic cancers; somaticmutation).
137L -> P (in sporadic cancers; somaticmutation).
137L -> Q (in sporadic cancers; somaticmutation).
137L -> V (in sporadic cancers; somaticmutation).
138A -> D (in sporadic cancers; somaticmutation).
138A -> P (in LFS; germline mutation and insporadic cancers; somatic mutation;
138A -> S (in LFS; germline mutation). VAR_044764
138A -> T (in sporadic cancers; somaticmutation).
138A -> V (in sporadic cancers; somaticmutation).
139K -> E (in sporadic cancers; somaticmutation).
139K -> N (in sporadic cancers; somaticmutation).
139K -> Q (in sporadic cancers; somaticmutation).
139K -> R (in sporadic cancers; somaticmutation).
139K -> T (in sporadic cancers; somaticmutation).
140T -> A (in sporadic cancers; somaticmutation).
140T -> I (in sporadic cancers; somaticmutation).
140T -> N (in a sporadic cancer; somaticmutation).
140T -> P (in a sporadic cancer; somaticmutation).
140T -> S (in sporadic cancers; somaticmutation).
141C -> A (in a sporadic cancer; somaticmutation; requires 2 nucleotide
141C -> F (in sporadic cancers; somaticmutation).
141C -> G (in sporadic cancers; somaticmutation).
141C -> R (in sporadic cancers; somaticmutation).
141C -> S (in sporadic cancers; somaticmutation).
141C -> W (in sporadic cancers; somaticmutation).
141C -> Y (in LFS; germline mutation and insporadic cancers; somatic mutation).
142P -> A (in sporadic cancers; somaticmutation).
142P -> F (in sporadic cancers; somaticmutation; requires 2 nucleotide
142P -> H (in sporadic cancers; somaticmutation).
142P -> L (in sporadic cancers; somaticmutation).
142P -> R (in a sporadic cancer; somaticmutation).
142P -> S (in sporadic cancers; somaticmutation).
142P -> T (in sporadic cancers; somaticmutation).
143V -> A (in sporadic cancers; somaticmutation; strong DNA binding ability at
143V -> E (in sporadic cancers; somaticmutation).
143V -> G (in sporadic cancers; somaticmutation).
143V -> L (in sporadic cancers; somaticmutation).
143V -> M (in sporadic cancers; somaticmutation).
144Q -> H (in sporadic cancers; somaticmutation).
144Q -> K (in sporadic cancers; somaticmutation).
144Q -> L (in LFS; germline mutation and insporadic cancers; somatic mutation).
144Q -> P (in sporadic cancers; somaticmutation).
144Q -> R (in sporadic cancers; somaticmutation).
145L -> M (in sporadic cancers; somaticmutation).
145L -> P (in sporadic cancers; somaticmutation).
145L -> Q (in sporadic cancers; somaticmutation).
145L -> R (in sporadic cancers; somaticmutation).
145L -> V (in sporadic cancers; somaticmutation).
146W -> C (in a sporadic cancer; somaticmutation).
146W -> G (in sporadic cancers; somaticmutation).
146W -> L (in sporadic cancers; somaticmutation).
146W -> R (in sporadic cancers; somaticmutation).
146W -> S (in sporadic cancers; somaticmutation).
147V -> A (in sporadic cancers; somaticmutation).
147V -> D (in sporadic cancers; somaticmutation).
147V -> E (in sporadic cancers; somaticmutation).
147V -> F (in a sporadic cancer; somaticmutation).
147V -> G (in sporadic cancers; somaticmutation).
147V -> I (in sporadic cancers; somaticmutation).
148D -> A (in a sporadic cancer; somaticmutation).
148D -> E (in sporadic cancers; somaticmutation).
148D -> G (in a sporadic cancer; somaticmutation).
148D -> N (in sporadic cancers; somaticmutation).
148D -> V (in sporadic cancers; somaticmutation).
148D -> Y (in sporadic cancers; somaticmutation).
149S -> F (in sporadic cancers; somaticmutation).
149S -> P (in sporadic cancers; somaticmutation).
149S -> T (in sporadic cancers; somaticmutation).
150T -> A (in a sporadic cancer; somaticmutation).
150T -> I (in sporadic cancers; somaticmutation).
150T -> K (in sporadic cancers; somaticmutation).
150T -> N (in a sporadic cancer; somaticmutation).
150T -> P (in a sporadic cancer; somaticmutation).
150T -> R (in a sporadic cancer; somaticmutation).
151P -> A (in sporadic cancers; somaticmutation).
151P -> H (in sporadic cancers; somaticmutation).
151P -> L (in sporadic cancers; somaticmutation).
151P -> R (in sporadic cancers; somaticmutation).
151P -> S (in LFS; germline mutation and insporadic cancers; somatic mutation;
151P -> T (in LFS; germline mutation and insporadic cancers; somatic mutation).
152P -> A (in sporadic cancers; somaticmutation).
152P -> L (in LFS; germline mutation and insporadic cancers; somatic mutation).
152P -> Q (in sporadic cancers; somaticmutation).
152P -> R (in sporadic cancers; somaticmutation).
152P -> S (in sporadic cancers; somaticmutation).
152P -> T (in sporadic cancers; somaticmutation).
153P -> A (in sporadic cancers; somaticmutation).
153P -> F (in a sporadic cancer; somaticmutation; requires 2 nucleotide
153P -> H (in a sporadic cancer; somaticmutation).
153P -> L (in sporadic cancers; somaticmutation).
153P -> R (in a sporadic cancer; somaticmutation).
153P -> S (in sporadic cancers; somaticmutation).
153P -> T (in sporadic cancers; somaticmutation).
154G -> A (in sporadic cancers; somaticmutation).
154G -> C (in a sporadic cancer; somaticmutation).
154G -> D (in sporadic cancers; somaticmutation).
154G -> I (in sporadic cancers; somaticmutation; requires 2 nucleotide
154G -> S (in sporadic cancers; somaticmutation).
154G -> V (in a brain tumor with no familyhistory; germline mutation and in
155T -> A (in sporadic cancers; somaticmutation).
155T -> I (in sporadic cancers; somaticmutation).
155T -> M (in a sporadic cancer; somaticmutation).
155T -> N (in LFS; germline mutation and insporadic cancers; somatic mutation).
155T -> P (in sporadic cancers; somaticmutation).
155T -> S (in sporadic cancers; somaticmutation).
156R -> C (in sporadic cancers; somaticmutation).
156R -> G (in sporadic cancers; somaticmutation).
156R -> H (in LFS; germline mutation and insporadic cancers; somatic mutation).
156R -> L (in sporadic cancers; somaticmutation).
156R -> P (in sporadic cancers; somaticmutation).
156R -> S (in sporadic cancers; somaticmutation).
157V -> A (in sporadic cancers; somaticmutation).
157V -> D (in sporadic cancers; somaticmutation).
157V -> F (in sporadic cancers; somaticmutation).
157V -> G (in sporadic cancers; somaticmutation).
157V -> I (in sporadic cancers; somaticmutation).
157V -> L (in sporadic cancers; somaticmutation).
158R -> C (in sporadic cancers; somaticmutation).
158R -> F (in a sporadic cancer; somaticmutation; requires 2 nucleotide
158R -> G (in LFS; germline mutation and insporadic cancers; somatic mutation).
158R -> H (in LFS; germline mutation and insporadic cancers; somatic mutation).
158R -> L (in sporadic cancers; somaticmutation).
158R -> P (in sporadic cancers; somaticmutation).
158R -> Q (in a sporadic cancer; somaticmutation).
158R -> S (in sporadic cancers; somaticmutation).
158R -> Y (in a sporadic cancer; somaticmutation; requires 2 nucleotide
159A -> D (in sporadic cancers; somaticmutation).
159A -> F (in a sporadic cancer; somaticmutation; requires 2 nucleotide
159A -> G (in sporadic cancers; somaticmutation).
159A -> P (in sporadic cancers; somaticmutation).
159A -> S (in sporadic cancers; somaticmutation).
159A -> T (in sporadic cancers; somaticmutation).
159A -> V (in sporadic cancers; somaticmutation).
160MA -> IP (in a sporadic cancer; somaticmutation).
160MA -> IS (in sporadic cancers; somaticmutation).
160MA -> IT (in a sporadic cancer; somaticmutation).
160M -> I (in sporadic cancers; somaticmutation).
160M -> K (in sporadic cancers; somaticmutation).
160M -> T (in a sporadic cancer; somaticmutation).
160M -> V (in sporadic cancers; somaticmutation).
161A -> D (in sporadic cancers; somaticmutation).
161A -> F (in a sporadic cancer; somaticmutation; requires 2 nucleotide
161A -> G (in sporadic cancers; somaticmutation).
161A -> P (in sporadic cancers; somaticmutation).
161A -> S (in sporadic cancers; somaticmutation).
161A -> T (in sporadic cancers; somaticmutation).
161A -> V (in sporadic cancers; somaticmutation).
162I -> F (in sporadic cancers; somaticmutation).
162I -> M (in sporadic cancers; somaticmutation).
162I -> N (in a breast cancer with no familyhistory; germline mutation and in
162I -> S (in sporadic cancers; somaticmutation).
162I -> T (in sporadic cancers; somaticmutation).
162I -> V (in sporadic cancers; somaticmutation).
163Y -> C (in LFS; germline mutation and insporadic cancers; somatic mutation).
163Y -> D (in sporadic cancers; somaticmutation).
163Y -> F (in a sporadic cancer; somaticmutation).
163Y -> H (in sporadic cancers; somaticmutation).
163Y -> N (in sporadic cancers; somaticmutation).
163Y -> S (in sporadic cancers; somaticmutation).
164K -> E (in sporadic cancers; somaticmutation).
164K -> M (in sporadic cancers; somaticmutation).
164K -> N (in sporadic cancers; somaticmutation).
164K -> Q (in sporadic cancers; somaticmutation).
164K -> R (in sporadic cancers; somaticmutation).
164K -> T (in sporadic cancers; somaticmutation).
165Q -> E (in sporadic cancers; somaticmutation).
165Q -> H (in a sporadic cancer; somaticmutation).
165Q -> L (in sporadic cancers; somaticmutation).
165Q -> P (in sporadic cancers; somaticmutation).
165Q -> R (in sporadic cancers; somaticmutation).
166S -> A (in sporadic cancers; somaticmutation).
166S -> G (in a sporadic cancer; somaticmutation).
166S -> L (in sporadic cancers; somaticmutation).
166S -> P (in sporadic cancers; somaticmutation).
166S -> T (in sporadic cancers; somaticmutation).
167QH -> HD (in a sporadic cancer; somaticmutation).
167QH -> YL (in a sporadic cancer; somaticmutation).
167Q -> H (in sporadic cancers; somaticmutation).
167Q -> K (in LFS; germline mutation and ina sporadic cancer; somatic mutation).
167Q -> L (in sporadic cancers; somaticmutation).
167Q -> R (in sporadic cancers; somaticmutation).
168HM -> LI (in a sporadic cancer; somaticmutation).
168H -> D (in sporadic cancers; somaticmutation).
168H -> L (in sporadic cancers; somaticmutation).
168H -> N (in sporadic cancers; somaticmutation).
168H -> P (in sporadic cancers; somaticmutation).
168H -> Q (in sporadic cancers; somaticmutation).
168H -> R (in sporadic cancers; somaticmutation).
168H -> V (in a sporadic cancer; somaticmutation; requires 2 nucleotide
168H -> Y (in sporadic cancers; somaticmutation).
169MT -> IS (in a sporadic cancer; somaticmutation).
169M -> I (in sporadic cancers; somaticmutation).
169M -> K (in sporadic cancers; somaticmutation).
169M -> T (in sporadic cancers; somaticmutation).
169M -> V (in sporadic cancers; somaticmutation).
170T -> A (in sporadic cancers; somaticmutation).
170T -> K (in a sporadic cancer; somaticmutation).
170T -> M (in sporadic cancers; somaticmutation).
170T -> P (in a sporadic cancer; somaticmutation).
170T -> S (in sporadic cancers; somaticmutation).
171E -> A (in a sporadic cancer; somaticmutation).
171E -> D (in sporadic cancers; somaticmutation).
171E -> G (in sporadic cancers; somaticmutation).
171E -> K (in sporadic cancers; somaticmutation).
171E -> Q (in a sporadic cancer; somaticmutation).
171E -> V (in sporadic cancers; somaticmutation).
172V -> A (in sporadic cancers; somaticmutation).
172V -> D (in sporadic cancers; somaticmutation).
172V -> F (in LFS; germline mutation and insporadic cancers; somatic mutation).
172V -> G (in sporadic cancers; somaticmutation).
172V -> I (in sporadic cancers; somaticmutation).
173V -> A (in sporadic cancers; somaticmutation).
173V -> E (in sporadic cancers; somaticmutation).
173V -> G (in sporadic cancers; somaticmutation).
173V -> L (in sporadic cancers; somaticmutation).
173V -> M (in LFS; germline mutation and insporadic cancers; somatic mutation).
173V -> W (in a sporadic cancer; somaticmutation; requires 2 nucleotide
174R -> G (in LFS; germline mutation and ina sporadic cancer; somatic mutation).
174R -> K (in sporadic cancers; somaticmutation).
174R -> M (in sporadic cancers; somaticmutation).
174R -> S (in sporadic cancers; somaticmutation).
174R -> T (in a sporadic cancer; somaticmutation).
174R -> W (in sporadic cancers; somaticmutation).
175R -> C (in sporadic cancers; somaticmutation).
175R -> G (in LFS; germline mutation and insporadic cancers; somatic mutation).
175R -> H (in LFS; germline mutation and insporadic cancers; somatic mutation;
175R -> L (in LFS; germline mutation and insporadic cancers; somatic mutation).
175R -> P (in sporadic cancers; somaticmutation).
175R -> Q (in a sporadic cancer; somaticmutation).
175R -> S (in sporadic cancers; somaticmutation).
176CP -> FS (in a sporadic cancer; somaticmutation).
176C -> F (in sporadic cancers; somaticmutation).
176C -> G (in sporadic cancers; somaticmutation).
176C -> R (in sporadic cancers; somaticmutation).
176C -> S (in sporadic cancers; somaticmutation).
176C -> W (in sporadic cancers; somaticmutation).
176C -> Y (in sporadic cancers; somaticmutation).
177P -> A (in a sporadic cancer; somaticmutation).
177P -> F (in sporadic cancers; somaticmutation; requires 2 nucleotide
177P -> H (in sporadic cancers; somaticmutation).
177P -> I (in a sporadic cancer; somaticmutation; requires 2 nucleotide
177P -> L (in sporadic cancers; somaticmutation).
177P -> R (in sporadic cancers; somaticmutation).
177P -> S (in sporadic cancers; somaticmutation).
177P -> T (in a sporadic cancer; somaticmutation).
178HH -> QS (in a sporadic cancer; somaticmutation).
178H -> D (in sporadic cancers; somaticmutation).
178H -> HPHP (in a Burkitt lymphoma). VAR_005936
178H -> L (in a sporadic cancer; somaticmutation).
178H -> N (in sporadic cancers; somaticmutation).
178H -> P (in sporadic cancers; somaticmutation).
178H -> Q (in sporadic cancers; somaticmutation).
178H -> R (in sporadic cancers; somaticmutation).
178H -> Y (in sporadic cancers; somaticmutation).
179H -> D (in sporadic cancers; somaticmutation).
179H -> L (in sporadic cancers; somaticmutation).
179H -> N (in sporadic cancers; somaticmutation).
179H -> P (in sporadic cancers; somaticmutation).
179H -> Q (in sporadic cancers; somaticmutation).
179H -> R (in sporadic cancers; somaticmutation).
179H -> Y (in LFS; germline mutation and insporadic cancers; somatic mutation).
180E -> A (in a sporadic cancer; somaticmutation).
180E -> D (in sporadic cancers; somaticmutation).
180E -> G (in a sporadic cancer; somaticmutation).
180E -> K (in LFS; germline mutation and insporadic cancers; somatic mutation).
180E -> Q (in sporadic cancers; somaticmutation).
180E -> V (in a sporadic cancer; somaticmutation).
181R -> C (in LFS; germline mutation and insporadic cancers; somatic mutation).
181R -> G (in sporadic cancers; somaticmutation).
181R -> H (in LFS; germline mutation and insporadic cancers; somatic mutation).
181R -> L (in a familial cancer not matchingLFS; germline mutation and in sporadic
181R -> P (in a familial cancer not matchingLFS; germline mutation and in sporadic
181R -> S (in sporadic cancers; somaticmutation).
182C -> R (in sporadic cancers; somaticmutation).
182C -> S (in sporadic cancers; somaticmutation).
182C -> Y (in sporadic cancers; somaticmutation).
183S -> L (in sporadic cancers; somaticmutation).
183S -> P (in sporadic cancers; somaticmutation).
184D -> G (in sporadic cancers; somaticmutation).
184D -> H (in sporadic cancers; somaticmutation).
184D -> N (in sporadic cancers; somaticmutation).
184D -> V (in sporadic cancers; somaticmutation).
184D -> Y (in sporadic cancers; somaticmutation).
185S -> C (in a sporadic cancer; somaticmutation).
185S -> G (in sporadic cancers; somaticmutation).
185S -> I (in sporadic cancers; somaticmutation).
185S -> N (in a sporadic cancer; somaticmutation).
185S -> R (in sporadic cancers; somaticmutation).
185S -> T (in a sporadic cancer; somaticmutation).
186D -> E (in a sporadic cancer; somaticmutation).
186D -> G (in sporadic cancers; somaticmutation).
186D -> H (in sporadic cancers; somaticmutation).
186D -> N (in sporadic cancers; somaticmutation).
186D -> V (in sporadic cancers; somaticmutation).
186D -> Y (in a sporadic cancer; somaticmutation).
187G -> C (in sporadic cancers; somaticmutation).
187G -> D (in sporadic cancers; somaticmutation).
187G -> N (in a sporadic cancer; somaticmutation; requires 2 nucleotide
187G -> R (in sporadic cancers; somaticmutation).
187G -> S (in sporadic cancers; somaticmutation).
187G -> V (in sporadic cancers; somaticmutation).
188L -> P (in a sporadic cancer; somaticmutation).
188L -> V (in sporadic cancers; somaticmutation).
189A -> D (in a sporadic cancer; somaticmutation).
189A -> G (in sporadic cancers; somaticmutation).
189A -> P (in sporadic cancers; somaticmutation).
189A -> S (in a sporadic cancer; somaticmutation).
189A -> T (in sporadic cancers; somaticmutation).
189A -> V (in a familial cancer not matchingLFS; germline mutation and in sporadic
190P -> A (in sporadic cancers; somaticmutation).
190P -> H (in a sporadic cancer; somaticmutation).
190P -> L (in sporadic cancers; somaticmutation).
190P -> R (in sporadic cancers; somaticmutation).
190P -> S (in sporadic cancers; somaticmutation).
190P -> T (in sporadic cancers; somaticmutation).
191P -> H (in sporadic cancers; somaticmutation).
191P -> L (in sporadic cancers; somaticmutation).
191P -> R (in sporadic cancers; somaticmutation).
191P -> S (in sporadic cancers; somaticmutation).
191P -> T (in sporadic cancers; somaticmutation).
192QH -> HN (in a sporadic cancer; somaticmutation).
192QH -> HY (in a sporadic cancer; somaticmutation).
192Q -> H (in sporadic cancers; somaticmutation).
192Q -> K (in a sporadic cancer; somaticmutation).
192Q -> L (in sporadic cancers; somaticmutation).
192Q -> P (in sporadic cancers; somaticmutation).
192Q -> R (in sporadic cancers; somaticmutation).
193H -> D (in sporadic cancers; somaticmutation).
193H -> L (in sporadic cancers; somaticmutation).
193H -> N (in sporadic cancers; somaticmutation).
193H -> P (in sporadic cancers; somaticmutation).
193H -> Q (in sporadic cancers; somaticmutation).
193H -> R (in LFS; germline mutation and insporadic cancers; somatic mutation).
193H -> Y (in sporadic cancers; somaticmutation).
194L -> F (in sporadic cancers; somaticmutation).
194L -> H (in sporadic cancers; somaticmutation).
194L -> I (in sporadic cancers; somaticmutation).
194L -> P (in sporadic cancers; somaticmutation).
194L -> R (in sporadic cancers; somaticmutation).
194L -> V (in sporadic cancers; somaticmutation).
195I -> F (in sporadic cancers; somaticmutation).
195I -> L (in a sporadic cancer; somaticmutation).
195I -> N (in sporadic cancers; somaticmutation).
195I -> S (in sporadic cancers; somaticmutation).
195I -> T (in sporadic cancers; somaticmutation).
195I -> V (in a sporadic cancer; somaticmutation).
195I -> Y (in a sporadic cancer; somaticmutation; requires 2 nucleotide
196R -> G (in sporadic cancers; somaticmutation).
196R -> L (in sporadic cancers; somaticmutation).
196R -> P (in LFS; germline mutation and insporadic cancers; somatic mutation).
196R -> Q (in sporadic cancers; somaticmutation).
196R -> S (in a sporadic cancer; somaticmutation).
197V -> E (in a familial cancer not matchingLFS; germline mutation and in sporadic
197V -> G (in sporadic cancers; somaticmutation).
197V -> L (in sporadic cancers; somaticmutation).
197V -> M (in LFS; germline mutation and insporadic cancers; somatic mutation).
198E -> D (in a sporadic cancer; somaticmutation).
198E -> G (in sporadic cancers; somaticmutation).
198E -> K (in sporadic cancers; somaticmutation).
198E -> Q (in sporadic cancers; somaticmutation).
198E -> V (in a sporadic cancer; somaticmutation).
199G -> A (in a sporadic cancer; somaticmutation).
199G -> E (in sporadic cancers; somaticmutation).
199G -> R (in sporadic cancers; somaticmutation).
199G -> V (in sporadic cancers; somaticmutation).
200N -> D (in sporadic cancers; somaticmutation).
200N -> I (in sporadic cancers; somaticmutation).
200N -> K (in a sporadic cancer; somaticmutation).
200N -> P (in a sporadic cancer; somaticmutation; requires 2 nucleotide
200N -> S (in sporadic cancers; somaticmutation).
200N -> T (in a sporadic cancer; somaticmutation).
201LR -> FC (in a sporadic cancer; somaticmutation).
201L -> F (in sporadic cancers; somaticmutation).
201L -> P (in a sporadic cancer; somaticmutation).
201L -> S (in a sporadic cancer; somaticmutation).
202R -> C (in sporadic cancers; somaticmutation).
202R -> G (in sporadic cancers; somaticmutation).
202R -> H (in sporadic cancers; somaticmutation).
202R -> L (in sporadic cancers; somaticmutation).
202R -> P (in sporadic cancers; somaticmutation).
202R -> S (in sporadic cancers; somaticmutation).
203VE -> LV (in a sporadic cancer; somaticmutation).
203V -> A (in sporadic cancers; somaticmutation).
203V -> E (in sporadic cancers; somaticmutation).
203V -> L (in sporadic cancers; somaticmutation).
203V -> M (in sporadic cancers; somaticmutation).
203V -> W (in a sporadic cancer; somaticmutation; requires 2 nucleotide
204E -> A (in sporadic cancers; somaticmutation).
204E -> D (in sporadic cancers; somaticmutation).
204E -> G (in sporadic cancers; somaticmutation).
204E -> K (in sporadic cancers; somaticmutation).
204E -> Q (in a sporadic cancer; somaticmutation).
204E -> V (in a sporadic cancer; somaticmutation).
205Y -> C (in sporadic cancers; somaticmutation).
205Y -> D (in sporadic cancers; somaticmutation).
205Y -> F (in sporadic cancers; somaticmutation).
205Y -> H (in sporadic cancers; somaticmutation).
205Y -> N (in sporadic cancers; somaticmutation).
205Y -> S (in sporadic cancers; somaticmutation).
206L -> F (in a sporadic cancer; somaticmutation).
206L -> M (in a sporadic cancer; somaticmutation).
207DD -> EY (in a sporadic cancer; somaticmutation).
207D -> E (in sporadic cancers; somaticmutation).
207D -> G (in sporadic cancers; somaticmutation).
207D -> H (in sporadic cancers; somaticmutation).
207D -> N (in sporadic cancers; somaticmutation).
207D -> V (in a sporadic cancer; somaticmutation).
207D -> Y (in a sporadic cancer; somaticmutation).
208D -> E (in sporadic cancers; somaticmutation).
208D -> G (in sporadic cancers; somaticmutation).
208D -> H (in a sporadic cancer; somaticmutation).
208D -> I (in a sporadic cancer; somaticmutation; requires 2 nucleotide
208D -> N (in sporadic cancers; somaticmutation).
208D -> V (in sporadic cancers; somaticmutation).
208D -> Y (in a sporadic cancer; somaticmutation).
209R -> I (in sporadic cancers; somaticmutation).
209R -> K (in sporadic cancers; somaticmutation).
209R -> S (in a sporadic cancer; somaticmutation).
209R -> T (in sporadic cancers; somaticmutation).
210N -> D (in sporadic cancers; somaticmutation).
210N -> H (in sporadic cancers; somaticmutation).
210N -> I (in a sporadic cancer; somaticmutation).
210N -> K (in a sporadic cancer; somaticmutation).
210N -> S (in sporadic cancers; somaticmutation).
210N -> T (in a sporadic cancer; somaticmutation).
210N -> Y (in a familial cancer not matchingLFS; germline mutation).
211T -> A (in sporadic cancers; somaticmutation).
211T -> I (in sporadic cancers; somaticmutation).
211T -> N (in sporadic cancers; somaticmutation).
211T -> P (in a sporadic cancer; somaticmutation).
211T -> S (in sporadic cancers; somaticmutation).
212F -> I (in sporadic cancers; somaticmutation).
212F -> L (in sporadic cancers; somaticmutation).
212F -> S (in sporadic cancers; somaticmutation).
212F -> V (in a sporadic cancer; somaticmutation).
212F -> Y (in sporadic cancers; somaticmutation).
213R -> G (in sporadic cancers; somaticmutation).
213R -> L (in sporadic cancers; somaticmutation).
213R -> P (in LFS; germline mutation and insporadic cancers; somatic mutation).
213R -> Q (in LFS; germline mutation and insporadic cancers; somatic mutation).
213R -> W (in sporadic cancers; somaticmutation).
214H -> D (in sporadic cancers; somaticmutation).
214H -> P (in a sporadic cancer; somaticmutation).
214H -> Q (in sporadic cancers; somaticmutation).
214H -> R (in sporadic cancers; somaticmutation).
214H -> Y (in sporadic cancers; somaticmutation).
215S -> C (in sporadic cancers; somaticmutation).
215S -> G (in sporadic cancers; somaticmutation).
215S -> I (in sporadic cancers; somaticmutation).
215S -> K (in sporadic cancers; somaticmutation; requires 2 nucleotide
215S -> N (in sporadic cancers; somaticmutation).
215S -> R (in sporadic cancers; somaticmutation).
215S -> T (in sporadic cancers; somaticmutation).
216V -> A (in sporadic cancers; somaticmutation).
216V -> E (in sporadic cancers; somaticmutation).
216V -> G (in sporadic cancers; somaticmutation).
216V -> L (in sporadic cancers; somaticmutation).
216V -> M (in sporadic cancers; somaticmutation).
216V -> W (in a sporadic cancer; somaticmutation; requires 2 nucleotide
217V -> A (in sporadic cancers; somaticmutation).
217V -> E (in sporadic cancers; somaticmutation).
217V -> G (in sporadic cancers; somaticmutation).
217V -> I (in a sporadic cancer; somaticmutation).
217V -> L (in sporadic cancers; somaticmutation).
217V -> M (in dbSNP:rs35163653). VAR_047178
218V -> A (in sporadic cancers; somaticmutation).
218V -> E (in sporadic cancers; somaticmutation).
218V -> G (in sporadic cancers; somaticmutation).
218V -> L (in sporadic cancers; somaticmutation).
218V -> M (in sporadic cancers; somaticmutation).
219P -> C (in a sporadic cancer; somaticmutation; requires 2 nucleotide
219P -> H (in a sporadic cancer; somaticmutation).
219P -> L (in sporadic cancers; somaticmutation).
219P -> R (in a sporadic cancer; somaticmutation).
219P -> S (in a familial cancer not matchingLFS; germline mutation and in sporadic
219P -> T (in sporadic cancers; somaticmutation).
220Y -> C (in LFS; germline mutation and insporadic cancers; somatic mutation).
220Y -> D (in sporadic cancers; somaticmutation).
220Y -> F (in a sporadic cancer; somaticmutation).
220Y -> H (in sporadic cancers; somaticmutation).
220Y -> N (in sporadic cancers; somaticmutation).
220Y -> S (in a brain tumor with no familyhistory; germline mutation and in
221E -> A (in sporadic cancers; somaticmutation).
221E -> D (in sporadic cancers; somaticmutation).
221E -> G (in sporadic cancers; somaticmutation).
221E -> K (in sporadic cancers; somaticmutation).
221E -> Q (in sporadic cancers; somaticmutation).
222P -> A (in a sporadic cancer; somaticmutation).
222P -> L (in sporadic cancers; somaticmutation).
222P -> Q (in sporadic cancers; somaticmutation).
222P -> R (in a sporadic cancer; somaticmutation).
222P -> S (in sporadic cancers; somaticmutation).
222P -> T (in sporadic cancers; somaticmutation).
223P -> A (in a sporadic cancer; somaticmutation).
223P -> H (in sporadic cancers; somaticmutation).
223P -> L (in sporadic cancers; somaticmutation).
223P -> R (in a sporadic cancer; somaticmutation).
223P -> S (in a sporadic cancer; somaticmutation).
223P -> T (in a sporadic cancer; somaticmutation).
224E -> D (in sporadic cancers; somaticmutation).
224E -> G (in sporadic cancers; somaticmutation).
224E -> K (in sporadic cancers; somaticmutation).
224E -> V (in a sporadic cancer; somaticmutation).
225V -> A (in sporadic cancers; somaticmutation).
225V -> D (in a sporadic cancer; somaticmutation).
225V -> F (in sporadic cancers; somaticmutation).
225V -> G (in a sporadic cancer; somaticmutation).
225V -> I (in sporadic cancers; somaticmutation).
225V -> L (in a sporadic cancer; somaticmutation).
226G -> A (in sporadic cancers; somaticmutation).
226G -> D (in sporadic cancers; somaticmutation).
226G -> N (in a sporadic cancer; somaticmutation; requires 2 nucleotide
226G -> S (in sporadic cancers; somaticmutation).
226G -> V (in sporadic cancers; somaticmutation).
227S -> C (in sporadic cancers; somaticmutation).
227S -> F (in sporadic cancers; somaticmutation).
227S -> P (in a sporadic cancer; somaticmutation).
227S -> T (in LFS; germline mutation and ina sporadic cancer; somatic mutation).
228D -> A (in sporadic cancers; somaticmutation).
228D -> E (in sporadic cancers; somaticmutation).
228D -> G (in sporadic cancers; somaticmutation).
228D -> H (in sporadic cancers; somaticmutation).
228D -> N (in sporadic cancers; somaticmutation).
228D -> P (in a sporadic cancer; somaticmutation; requires 2 nucleotide
228D -> V (in sporadic cancers; somaticmutation).
228D -> Y (in sporadic cancers; somaticmutation).
229C -> G (in a sporadic cancer; somaticmutation).
229C -> N (in a sporadic cancer; somaticmutation; requires 2 nucleotide
229C -> R (in sporadic cancers; somaticmutation).
229C -> S (in sporadic cancers; somaticmutation).
229C -> Y (in sporadic cancers; somaticmutation).
230T -> A (in sporadic cancers; somaticmutation).
230T -> I (in sporadic cancers; somaticmutation).
230T -> N (in sporadic cancers; somaticmutation).
230T -> P (in sporadic cancers; somaticmutation).
230T -> S (in sporadic cancers; somaticmutation).
231T -> A (in sporadic cancers; somaticmutation).
231T -> I (in sporadic cancers; somaticmutation).
231T -> N (in sporadic cancers; somaticmutation).
231T -> S (in sporadic cancers; somaticmutation).
232I -> F (in sporadic cancers; somaticmutation).
232I -> L (in sporadic cancers; somaticmutation).
232I -> N (in sporadic cancers; somaticmutation).
232I -> S (in sporadic cancers; somaticmutation).
232I -> T (in sporadic cancers; somaticmutation).
232I -> V (in sporadic cancers; somaticmutation).
233H -> D (in LFS; germline mutation and ina sporadic cancer; somatic mutation).
233H -> L (in sporadic cancers; somaticmutation).
233H -> P (in a sporadic cancer; somaticmutation).
233H -> Q (in sporadic cancers; somaticmutation).
233H -> R (in sporadic cancers; somaticmutation).
233H -> Y (in sporadic cancers; somaticmutation).
234Y -> C (in LFS; germline mutation and insporadic cancers; somatic mutation).
234Y -> D (in sporadic cancers; somaticmutation).
234Y -> F (in a sporadic cancer; somaticmutation).
234Y -> H (in sporadic cancers; somaticmutation).
234Y -> K (in a sporadic cancer; somaticmutation; requires 2 nucleotide
234Y -> N (in sporadic cancers; somaticmutation).
234Y -> Q (in a sporadic cancer; somaticmutation; requires 2 nucleotide
234Y -> S (in sporadic cancers; somaticmutation).
235N -> D (in an adrenocortical carcinomawith no family history; germline mutation
235N -> H (in a sporadic cancer; somaticmutation).
235N -> I (in sporadic cancers; somaticmutation).
235N -> M (in a sporadic cancer; somaticmutation; requires 2 nucleotide
235N -> S (in LFS; germline mutation and insporadic cancers; somatic mutation).
235N -> T (in sporadic cancers; somaticmutation).
235N -> Y (in sporadic cancers; somaticmutation).
236Y -> C (in LFS; germline mutation and insporadic cancers; somatic mutation).
236Y -> D (in sporadic cancers; somaticmutation).
236Y -> F (in a sporadic cancer; somaticmutation).
236Y -> H (in sporadic cancers; somaticmutation).
236Y -> N (in sporadic cancers; somaticmutation).
236Y -> S (in sporadic cancers; somaticmutation).
237M -> I (in LFS; germline mutation and insporadic cancers; somatic mutation).
237M -> K (in sporadic cancers; somaticmutation).
237M -> L (in sporadic cancers; somaticmutation).
237M -> R (in sporadic cancers; somaticmutation).
237M -> T (in sporadic cancers; somaticmutation).
237M -> V (in sporadic cancers; somaticmutation).
238C -> F (in sporadic cancers; somaticmutation).
238C -> G (in LFS; germline mutation and insporadic cancers; somatic mutation).
238C -> H (in a sporadic cancer; somaticmutation; requires 2 nucleotide
238C -> R (in sporadic cancers; somaticmutation).
238C -> S (in LFS; germline mutation and insporadic cancers; somatic mutation).
238C -> W (in sporadic cancers; somaticmutation).
238C -> Y (in a familial cancer not matchingLFS; germline mutation and in sporadic
239N -> D (in sporadic cancers; somaticmutation).
239N -> H (in a sporadic cancer; somaticmutation).
239N -> I (in a sporadic cancer; somaticmutation).
239N -> K (in sporadic cancers; somaticmutation).
239N -> S (in sporadic cancers; somaticmutation).
239N -> T (in sporadic cancers; somaticmutation).
239N -> Y (in sporadic cancers; somaticmutation).
240S -> C (in sporadic cancers; somaticmutation).
240S -> G (in sporadic cancers; somaticmutation).
240S -> I (in sporadic cancers; somaticmutation).
240S -> N (in sporadic cancers; somaticmutation).
240S -> P (in a sporadic cancer; somaticmutation).
240S -> R (in sporadic cancers; somaticmutation).
240S -> T (in sporadic cancers; somaticmutation).
241S -> A (in sporadic cancers; somaticmutation).
241S -> C (in sporadic cancers; somaticmutation).
241S -> F (in LFS; germline mutation and insporadic cancers; somatic mutation;
241S -> P (in sporadic cancers; somaticmutation).
241S -> T (in LFS; germline mutation and insporadic cancers; somatic mutation).
241S -> Y (in sporadic cancers; somaticmutation).
242C -> F (in sporadic cancers; somaticmutation).
242C -> G (in sporadic cancers; somaticmutation).
242C -> R (in sporadic cancers; somaticmutation).
242C -> S (in sporadic cancers; somaticmutation).
242C -> W (in sporadic cancers; somaticmutation).
242C -> Y (in a familial cancer not matchingLFS; germline mutation and in sporadic
243MG -> IC (in a sporadic cancer; somaticmutation).
243MG -> IS (in a sporadic cancer; somaticmutation).
243M -> I (in sporadic cancers; somaticmutation).
243M -> K (in sporadic cancers; somaticmutation).
243M -> L (in sporadic cancers; somaticmutation).
243M -> R (in sporadic cancers; somaticmutation).
243M -> T (in sporadic cancers; somaticmutation).
243M -> V (in sporadic cancers; somaticmutation).
244G -> A (in sporadic cancers; somaticmutation).
244G -> C (in sporadic cancers; somaticmutation).
244G -> D (in LFS; germline mutation and insporadic cancers; somatic mutation;
244G -> E (in a sporadic cancer; somaticmutation).
244G -> R (in sporadic cancers; somaticmutation).
244G -> S (in sporadic cancers; somaticmutation).
244G -> V (in LFS; germline mutation and insporadic cancers; somatic mutation).
245G -> A (in sporadic cancers; somaticmutation).
245G -> C (in LFS; germline mutation and insporadic cancers; somatic mutation).
245G -> D (in LFS; germline mutation and insporadic cancers; somatic mutation).
245G -> E (in a sporadic cancer; somaticmutation).
245G -> F (in sporadic cancers; somaticmutation; requires 2 nucleotide
245G -> H (in a sporadic cancer; somaticmutation; requires 2 nucleotide
245G -> L (in sporadic cancers; somaticmutation; requires 2 nucleotide
245G -> N (in sporadic cancers; somaticmutation; requires 2 nucleotide
245G -> R (in sporadic cancers; somaticmutation).
245G -> S (in LFS; germline mutation and insporadic cancers; somatic mutation;
245G -> V (in LFS; germline mutation and insporadic cancers; somatic mutation).
246M -> I (in sporadic cancers; somaticmutation).
246M -> K (in sporadic cancers; somaticmutation).
246M -> L (in sporadic cancers; somaticmutation).
246M -> R (in sporadic cancers; somaticmutation).
246M -> T (in sporadic cancers; somaticmutation).
246M -> V (in LFS; germline mutation and insporadic cancers; somatic mutation).
247NR -> IP (in a sporadic cancer; somaticmutation).
247NR -> KW (in sporadic cancers; somaticmutation).
247N -> D (in sporadic cancers; somaticmutation).
247N -> F (in a sporadic cancer; somaticmutation; requires 2 nucleotide
247N -> I (in sporadic cancers; somaticmutation).
247N -> K (in sporadic cancers; somaticmutation).
247N -> S (in sporadic cancers; somaticmutation).
247N -> T (in sporadic cancers; somaticmutation).
247N -> Y (in sporadic cancers; somaticmutation).
248R -> C (in a sporadic cancer; somaticmutation).
248R -> G (in sporadic cancers; somaticmutation).
248R -> L (in sporadic cancers; somaticmutation).
248R -> P (in sporadic cancers; somaticmutation).
248R -> Q (in LFS; germline mutation and insporadic cancers; somatic mutation;
248R -> W (in LFS; germline mutation and insporadic cancers; somatic mutation).
249RP -> SA (in a sporadic cancer; somaticmutation).
249RP -> SS (in sporadic cancers; somaticmutation).
249R -> G (in sporadic cancers; somaticmutation).
249R -> I (in a sporadic cancer; somaticmutation).
249R -> K (in sporadic cancers; somaticmutation).
249R -> M (in sporadic cancers; somaticmutation).
249R -> N (in a sporadic cancer; somaticmutation; requires 2 nucleotide
249R -> S (in sporadic cancers; somaticmutation; dbSNP:rs28934571).
249R -> T (in sporadic cancers; somaticmutation).
249R -> W (in sporadic cancers; somaticmutation).
250P -> A (in sporadic cancers; somaticmutation).
250P -> F (in sporadic cancers; somaticmutation; requires 2 nucleotide
250P -> H (in sporadic cancers; somaticmutation).
250P -> L (in sporadic cancers; somaticmutation).
250P -> N (in sporadic cancers; somaticmutation; requires 2 nucleotide
250P -> Q (in sporadic cancers; somaticmutation).
250P -> S (in sporadic cancers; somaticmutation).
250P -> T (in sporadic cancers; somaticmutation).
251I -> F (in sporadic cancers; somaticmutation).
251I -> L (in sporadic cancers; somaticmutation).
251I -> M (in LFS; germline mutation). VAR_045258
251I -> N (in sporadic cancers; somaticmutation).
251I -> S (in sporadic cancers; somaticmutation).
251I -> T (in sporadic cancers; somaticmutation).
251I -> V (in sporadic cancers; somaticmutation).
252L -> F (in sporadic cancers; somaticmutation).
252L -> H (in a sporadic cancer; somaticmutation).
252L -> I (in sporadic cancers; somaticmutation).
252L -> P (in LFS; germline mutation and insporadic cancers; somatic mutation).
252L -> V (in a sporadic cancer; somaticmutation).
253T -> A (in sporadic cancers; somaticmutation).
253T -> I (in sporadic cancers; somaticmutation).
253T -> N (in sporadic cancers; somaticmutation).
253T -> P (in sporadic cancers; somaticmutation).
253T -> S (in sporadic cancers; somaticmutation).
254I -> D (in sporadic cancers; somaticmutation; requires 2 nucleotide
254I -> F (in a sporadic cancer; somaticmutation).
254I -> L (in a sporadic cancer; somaticmutation).
254I -> M (in a sporadic cancer; somaticmutation).
254I -> N (in sporadic cancers; somaticmutation).
254I -> S (in sporadic cancers; somaticmutation).
254I -> T (in sporadic cancers; somaticmutation).
254I -> V (in sporadic cancers; somaticmutation).
255I -> F (in sporadic cancers; somaticmutation).
255I -> M (in sporadic cancers; somaticmutation).
255I -> N (in sporadic cancers; somaticmutation).
255I -> S (in sporadic cancers; somaticmutation).
255I -> T (in sporadic cancers; somaticmutation).
255I -> V (in sporadic cancers; somaticmutation).
256T -> I (in a brain tumor with no familyhistory; germline mutation and in
256T -> K (in sporadic cancers; somaticmutation).
256T -> P (in sporadic cancers; somaticmutation).
256T -> S (in sporadic cancers; somaticmutation).
257L -> P (in sporadic cancers; somaticmutation).
257L -> Q (in LFS; germline mutation and insporadic cancers; somatic mutation;
257L -> R (in sporadic cancers; somaticmutation).
257L -> V (in sporadic cancers; somaticmutation).
258E -> A (in sporadic cancers; somaticmutation).
258E -> D (in sporadic cancers; somaticmutation).
258E -> G (in sporadic cancers; somaticmutation).
258E -> K (in LFS; germline mutation and insporadic cancers; somatic mutation).
258E -> L (in a sporadic cancer; somaticmutation; requires 2 nucleotide
258E -> Q (in sporadic cancers; somaticmutation).
258E -> V (in sporadic cancers; somaticmutation).
259D -> A (in a sporadic cancer; somaticmutation).
259D -> E (in sporadic cancers; somaticmutation).
259D -> G (in sporadic cancers; somaticmutation).
259D -> H (in sporadic cancers; somaticmutation).
259D -> N (in sporadic cancers; somaticmutation).
259D -> P (in a sporadic cancer; somaticmutation; requires 2 nucleotide
259D -> S (in a sporadic cancer; somaticmutation; requires 2 nucleotide
259D -> V (in sporadic cancers; somaticmutation).
259D -> Y (in sporadic cancers; somaticmutation).
260S -> A (in sporadic cancers; somaticmutation).
260S -> C (in sporadic cancers; somaticmutation).
260S -> F (in sporadic cancers; somaticmutation).
260S -> P (in sporadic cancers; somaticmutation).
260S -> T (in a sporadic cancer; somaticmutation).
260S -> Y (in sporadic cancers; somaticmutation).
261S -> C (in a sporadic cancer; somaticmutation).
261S -> G (in sporadic cancers; somaticmutation).
261S -> I (in sporadic cancers; somaticmutation).
261S -> N (in a sporadic cancer; somaticmutation).
261S -> R (in sporadic cancers; somaticmutation).
262GN -> PD (in a sporadic cancer; somaticmutation).
262G -> C (in a sporadic cancer; somaticmutation).
262G -> D (in sporadic cancers; somaticmutation).
262G -> H (in a sporadic cancer; somaticmutation; requires 2 nucleotide
262G -> S (in sporadic cancers; somaticmutation).
262G -> V (in sporadic cancers; somaticmutation).
263N -> D (in sporadic cancers; somaticmutation).
263N -> H (in sporadic cancers; somaticmutation).
263N -> I (in sporadic cancers; somaticmutation).
263N -> K (in a sporadic cancer; somaticmutation).
263N -> S (in a sporadic cancer; somaticmutation).
264L -> I (in sporadic cancers; somaticmutation).
264L -> P (in a sporadic cancer; somaticmutation).
264L -> Q (in a sporadic cancer; somaticmutation).
264L -> R (in sporadic cancers; somaticmutation).
264L -> V (in a sporadic cancer; somaticmutation).
265L -> M (in sporadic cancers; somaticmutation).
265L -> P (in LFS; germline mutation and insporadic cancers; somatic mutation).
265L -> Q (in sporadic cancers; somaticmutation).
265L -> R (in sporadic cancers; somaticmutation).
266G -> A (in sporadic cancers; somaticmutation).
266G -> E (in sporadic cancers; somaticmutation).
266G -> R (in sporadic cancers; somaticmutation).
266G -> V (in sporadic cancers; somaticmutation).
267R -> G (in sporadic cancers; somaticmutation).
267R -> H (in a sporadic cancer; somaticmutation).
267R -> P (in sporadic cancers; somaticmutation).
267R -> Q (in LFS; germline mutation and insporadic cancers; somatic mutation).
267R -> W (in sporadic cancers; somaticmutation; dbSNP:rs55832599).
268N -> F (in a sporadic cancer; somaticmutation; requires 2 nucleotide
268N -> H (in sporadic cancers; somaticmutation).
268N -> I (in sporadic cancers; somaticmutation).
268N -> K (in a sporadic cancer; somaticmutation).
268N -> S (in sporadic cancers; somaticmutation).
268N -> Y (in a sporadic cancer; somaticmutation).
269S -> C (in sporadic cancers; somaticmutation).
269S -> G (in sporadic cancers; somaticmutation).
269S -> I (in a sporadic cancer; somaticmutation).
269S -> N (in sporadic cancers; somaticmutation).
269S -> R (in sporadic cancers; somaticmutation).
269S -> T (in a sporadic cancer; somaticmutation).
270F -> C (in sporadic cancers; somaticmutation).
270F -> I (in sporadic cancers; somaticmutation).
270F -> L (in sporadic cancers; somaticmutation).
270F -> S (in sporadic cancers; somaticmutation).
270F -> V (in sporadic cancers; somaticmutation).
270F -> Y (in sporadic cancers; somaticmutation).
271E -> A (in sporadic cancers; somaticmutation).
271E -> D (in sporadic cancers; somaticmutation).
271E -> G (in sporadic cancers; somaticmutation).
271E -> K (in sporadic cancers; somaticmutation).
271E -> P (in a sporadic cancer; somaticmutation; requires 2 nucleotide
271E -> Q (in sporadic cancers; somaticmutation).
271E -> R (in a sporadic cancer; somaticmutation; requires 2 nucleotide
271E -> V (in an osteosarcoma with no familyhistory; germline mutation and in
272V -> A (in a familial cancer not matchingLFS; germline mutation and in sporadic
272V -> E (in sporadic cancers; somaticmutation).
272V -> G (in sporadic cancers; somaticmutation).
272V -> L (in LFS; germline mutation and insporadic cancers; somatic mutation).
272V -> M (in sporadic cancers; somaticmutation).
273R -> C (in LFS; germline mutation and insporadic cancers; somatic mutation).
273R -> G (in LFS; germline mutation and insporadic cancers; somatic mutation).
273R -> H (in LFS; germline mutation and insporadic cancers; somatic mutation;
273R -> L (in LFS; germline mutation and insporadic cancers; somatic mutation).
273R -> N (in a sporadic cancer; somaticmutation; requires 2 nucleotide
273R -> P (in sporadic cancers; somaticmutation).
273R -> Q (in sporadic cancers; somaticmutation).
273R -> S (in a familial cancer not matchingLFS; germline mutation and in sporadic
273R -> Y (in a sporadic cancer; somaticmutation; requires 2 nucleotide
274V -> A (in sporadic cancers; somaticmutation).
274V -> D (in sporadic cancers; somaticmutation).
274V -> F (in sporadic cancers; somaticmutation).
274V -> G (in sporadic cancers; somaticmutation).
274V -> I (in sporadic cancers; somaticmutation).
274V -> L (in sporadic cancers; somaticmutation).
275C -> F (in sporadic cancers; somaticmutation).
275C -> G (in sporadic cancers; somaticmutation).
275C -> R (in sporadic cancers; somaticmutation).
275C -> S (in sporadic cancers; somaticmutation).
275C -> W (in sporadic cancers; somaticmutation).
275C -> Y (in LFS; germline mutation and insporadic cancers; somatic mutation).
276A -> D (in sporadic cancers; somaticmutation).
276A -> G (in sporadic cancers; somaticmutation).
276A -> P (in sporadic cancers; somaticmutation).
276A -> S (in sporadic cancers; somaticmutation).
276A -> T (in sporadic cancers; somaticmutation).
276A -> V (in sporadic cancers; somaticmutation).
277C -> F (in sporadic cancers; somaticmutation).
277C -> G (in sporadic cancers; somaticmutation).
277C -> R (in sporadic cancers; somaticmutation).
277C -> S (in sporadic cancers; somaticmutation).
277C -> W (in sporadic cancers; somaticmutation).
277C -> Y (in an osteosarcoma with no familyhistory; germline mutation and in
278P -> A (in sporadic cancers; somaticmutation; dbSNP:rs17849781).
278P -> F (in sporadic cancers; somaticmutation; requires 2 nucleotide
278P -> H (in sporadic cancers; somaticmutation).
278P -> L (in LFS; germline mutation and insporadic cancers; somatic mutation).
278P -> R (in sporadic cancers; somaticmutation).
278P -> S (in LFS; germline mutation and insporadic cancers; somatic mutation).
278P -> T (in LFS; germline mutation and insporadic cancers; somatic mutation).
279G -> E (in sporadic cancers; somaticmutation).
279G -> R (in sporadic cancers; somaticmutation).
279G -> V (in sporadic cancers; somaticmutation).
279G -> W (in sporadic cancers; somaticmutation).
280R -> G (in sporadic cancers; somaticmutation).
280R -> I (in sporadic cancers; somaticmutation).
280R -> K (in a familial cancer not matchingLFS; germline mutation and in sporadic
280R -> P (in a sporadic cancer; somaticmutation).
280R -> S (in sporadic cancers; somaticmutation).
280R -> T (in sporadic cancers; somaticmutation).
281DR -> EW (in sporadic cancers; somaticmutation).
281D -> A (in sporadic cancers; somaticmutation).
281D -> E (in sporadic cancers; somaticmutation).
281D -> G (in a brain tumor with no familyhistory; germline mutation and in
281D -> H (in sporadic cancers; somaticmutation).
281D -> N (in LFS; germline mutation and insporadic cancers; somatic mutation).
281D -> R (in a sporadic cancer; somaticmutation; requires 2 nucleotide
281D -> V (in a familial cancer not matchingLFS; germline mutation and in sporadic
281D -> Y (in sporadic cancers; somaticmutation).
282R -> G (in LFS; germline mutation and insporadic cancers; somatic mutation).
282R -> H (in a sporadic cancer; somaticmutation).
282R -> L (in sporadic cancers; somaticmutation).
282R -> P (in sporadic cancers; somaticmutation).
282R -> Q (in a familial cancer not matchingLFS; germline mutation and in sporadic
282R -> W (in LFS; germline mutation and insporadic cancers; somatic mutation;
283R -> C (in LFS; germline mutation and insporadic cancers; somatic mutation).
283R -> G (in sporadic cancers; somaticmutation).
283R -> H (in a brain tumor with no familyhistory; germline mutation and in
283R -> L (in sporadic cancers; somaticmutation).
283R -> P (in sporadic cancers; somaticmutation).
283R -> S (in a sporadic cancer; somaticmutation).
284T -> A (in sporadic cancers; somaticmutation).
284T -> I (in sporadic cancers; somaticmutation).
284T -> K (in sporadic cancers; somaticmutation).
284T -> P (in sporadic cancers; somaticmutation).
285E -> A (in a sporadic cancer; somaticmutation).
285E -> D (in sporadic cancers; somaticmutation).
285E -> G (in sporadic cancers; somaticmutation).
285E -> K (in sporadic cancers; somaticmutation).
285E -> Q (in LFS; germline mutation and insporadic cancers; somatic mutation).
285E -> V (in sporadic cancers; somaticmutation).
286E -> A (in LFS; germline mutation and insporadic cancers; somatic mutation).
286E -> D (in sporadic cancers; somaticmutation).
286E -> G (in sporadic cancers; somaticmutation).
286E -> K (in sporadic cancers; somaticmutation).
286E -> L (in a sporadic cancer; somaticmutation; requires 2 nucleotide
286E -> Q (in sporadic cancers; somaticmutation).
286E -> V (in sporadic cancers; somaticmutation).
287E -> A (in a sporadic cancer; somaticmutation).
287E -> D (in sporadic cancers; somaticmutation).
287E -> G (in sporadic cancers; somaticmutation).
287E -> K (in sporadic cancers; somaticmutation).
287E -> V (in sporadic cancers; somaticmutation).
288N -> D (in a sporadic cancer; somaticmutation).
288N -> K (in sporadic cancers; somaticmutation).
288N -> S (in sporadic cancers; somaticmutation).
288N -> T (in sporadic cancers; somaticmutation).
288N -> Y (in sporadic cancers; somaticmutation).
289L -> F (in sporadic cancers; somaticmutation).
289L -> H (in sporadic cancers; somaticmutation).
289L -> P (in sporadic cancers; somaticmutation).
289L -> R (in a sporadic cancer; somaticmutation).
289L -> V (in sporadic cancers; somaticmutation).
290R -> C (in sporadic cancers; somaticmutation).
290R -> H (in LFS; germline mutation and insporadic cancers; somatic mutation;
290R -> L (in LFS; germline mutation and insporadic cancers; somatic mutation).
291K -> E (in sporadic cancers; somaticmutation).
291K -> M (in sporadic cancers; somaticmutation).
291K -> N (in sporadic cancers; somaticmutation).
291K -> Q (in sporadic cancers; somaticmutation).
291K -> R (in sporadic cancers; somaticmutation).
291K -> T (in sporadic cancers; somaticmutation).
292K -> E (in sporadic cancers; somaticmutation).
292K -> G (in a sporadic cancer; somaticmutation; requires 2 nucleotide
292K -> I (in LFS; germline mutation and ina sporadic cancer; somatic mutation).
292K -> N (in sporadic cancers; somaticmutation).
292K -> Q (in a sporadic cancer; somaticmutation).
292K -> R (in sporadic cancers; somaticmutation).
292K -> T (in sporadic cancers; somaticmutation).
293G -> A (in a sporadic cancer; somaticmutation).
293G -> R (in sporadic cancers; somaticmutation).
293G -> V (in sporadic cancers; somaticmutation).
293G -> W (in a brain tumor with no familyhistory; germline mutation and in
294E -> A (in a sporadic cancer; somaticmutation).
294E -> D (in sporadic cancers; somaticmutation).
294E -> G (in sporadic cancers; somaticmutation).
294E -> K (in sporadic cancers; somaticmutation).
294E -> Q (in sporadic cancers; somaticmutation).
294E -> V (in sporadic cancers; somaticmutation).
295P -> H (in a sporadic cancer; somaticmutation).
295P -> L (in sporadic cancers; somaticmutation).
295P -> R (in a sporadic cancer; somaticmutation).
295P -> S (in sporadic cancers; somaticmutation).
296H -> C (in sporadic cancers; somaticmutation; requires 2 nucleotide
296H -> D (in sporadic cancers; somaticmutation).
296H -> L (in sporadic cancers; somaticmutation).
296H -> N (in sporadic cancers; somaticmutation).
296H -> P (in a sporadic cancer; somaticmutation).
296H -> Q (in sporadic cancers; somaticmutation).
296H -> R (in a sporadic cancer; somaticmutation).
296H -> Y (in sporadic cancers; somaticmutation).
297H -> D (in a sporadic cancer; somaticmutation).
297H -> N (in a sporadic cancer; somaticmutation).
297H -> P (in sporadic cancers; somaticmutation).
297H -> R (in sporadic cancers; somaticmutation).
297H -> Y (in sporadic cancers; somaticmutation).
298E -> A (in a sporadic cancer; somaticmutation).
298E -> D (in sporadic cancers; somaticmutation).
298E -> K (in sporadic cancers; somaticmutation).
298E -> Q (in sporadic cancers; somaticmutation).
298E -> V (in sporadic cancers; somaticmutation).
299L -> P (in sporadic cancers; somaticmutation).
299L -> Q (in sporadic cancers; somaticmutation).
299L -> R (in a sporadic cancer; somaticmutation).
299L -> V (in a sporadic cancer; somaticmutation).
300P -> A (in sporadic cancers; somaticmutation).
300P -> L (in sporadic cancers; somaticmutation).
300P -> R (in a sporadic cancer; somaticmutation).
300P -> S (in sporadic cancers; somaticmutation).
301P -> A (in sporadic cancers; somaticmutation).
301P -> L (in sporadic cancers; somaticmutation).
301P -> Q (in sporadic cancers; somaticmutation).
301P -> S (in sporadic cancers; somaticmutation).
301P -> T (in a sporadic cancer; somaticmutation).
302G -> A (in a sporadic cancer; somaticmutation).
302G -> E (in sporadic cancers; somaticmutation).
302G -> R (in a sporadic cancer; somaticmutation).
302G -> V (in a sporadic cancer; somaticmutation).
303S -> C (in sporadic cancers; somaticmutation).
303S -> I (in sporadic cancers; somaticmutation).
303S -> N (in sporadic cancers; somaticmutation).
303S -> T (in sporadic cancers; somaticmutation).
304T -> A (in sporadic cancers; somaticmutation).
304T -> I (in sporadic cancers; somaticmutation).
304T -> N (in a sporadic cancer; somaticmutation).
304T -> S (in a sporadic cancer; somaticmutation).
305K -> E (in a sporadic cancer; somaticmutation).
305K -> M (in a familial cancer not matchingLFS; germline mutation and in sporadic
305K -> N (in sporadic cancers; somaticmutation; loss of nuclear localization).
305K -> R (in sporadic cancers; somaticmutation).
305K -> T (in a sporadic cancer; somaticmutation).
306R -> P (in LFS; germline mutation and ina sporadic cancer; somatic mutation).
306R -> Q (in sporadic cancers; somaticmutation).
307A -> P (in a sporadic cancer; somaticmutation).
307A -> S (in sporadic cancers; somaticmutation).
307A -> T (in sporadic cancers; somaticmutation).
308L -> M (in sporadic cancers; somaticmutation).
308L -> V (in a sporadic cancer; somaticmutation).
309P -> R (in a sporadic cancer; somaticmutation).
309P -> S (in LFS; germline mutation and insporadic cancers; somatic mutation).
310N -> I (in a sporadic cancer; somaticmutation).
310N -> T (in sporadic cancers; somaticmutation).
311N -> H (in sporadic cancers; somaticmutation).
311N -> K (in a sporadic cancer; somaticmutation).
311N -> S (in a sporadic cancer; somaticmutation; dbSNP:rs56184981).
311N -> T (in sporadic cancers; somaticmutation).
312T -> I (in sporadic cancers; somaticmutation).
312T -> S (in sporadic cancers; somaticmutation).
313S -> C (in a sporadic cancer; somaticmutation).
313S -> I (in a sporadic cancer; somaticmutation).
313S -> N (in a sporadic cancer; somaticmutation).
313S -> R (in a sporadic cancer; somaticmutation).
314S -> F (in a sporadic cancer; somaticmutation).
315S -> C (in a sporadic cancer; somaticmutation).
315S -> F (in a sporadic cancer; somaticmutation).
315S -> P (in a sporadic cancer; somaticmutation).
316P -> L (in a sporadic cancer; somaticmutation).
316P -> T (in a sporadic cancer; somaticmutation).
317Q -> H (in a kidney cancer with no familyhistory; germline mutation and in a
317Q -> K (in sporadic cancers; somaticmutation).
317Q -> L (in a sporadic cancer; somaticmutation).
317Q -> P (in a sporadic cancer; somaticmutation).
317Q -> R (in sporadic cancers; somaticmutation).
318P -> L (in sporadic cancers; somaticmutation).
319K -> E (in sporadic cancers; somaticmutation).
319K -> N (in a sporadic cancer; somaticmutation).
319K -> R (in a sporadic cancer; somaticmutation).
320K -> N (in sporadic cancers; somaticmutation).
321K -> E (in kidney cancer; germlinemutation).
321K -> R (in a sporadic cancer; somaticmutation).
322P -> L (in sporadic cancers; somaticmutation).
322P -> R (in sporadic cancers; somaticmutation).
323L -> G (in a sporadic cancer; somaticmutation; requires 2 nucleotide
323L -> M (in a sporadic cancer; somaticmutation).
323L -> P (in a sporadic cancer; somaticmutation).
323L -> R (in a sporadic cancer; somaticmutation).
323L -> V (in a sporadic cancer; somaticmutation).
324D -> E (in sporadic cancers; somaticmutation).
324D -> S (in a sporadic cancer; somaticmutation; requires 2 nucleotide
324D -> Y (in a sporadic cancer; somaticmutation).
325G -> A (in a sporadic cancer; somaticmutation).
325G -> E (in sporadic cancers; somaticmutation).
325G -> V (in LFS; germline mutation;dbSNP:rs28934271).
326E -> G (in a sporadic cancer; somaticmutation).
327Y -> H (in a sporadic cancer; somaticmutation).
327Y -> S (in a sporadic cancer; somaticmutation).
328F -> L (in a sporadic cancer; somaticmutation).
328F -> S (in sporadic cancers; somaticmutation).
328F -> V (in a sporadic cancer; somaticmutation).
329T -> I (in a sporadic cancer; somaticmutation).
329T -> S (in a sporadic cancer; somaticmutation).
330L -> H (in sporadic cancers; somaticmutation).
330L -> P (in a sporadic cancer; somaticmutation).
330L -> R (in sporadic cancers; somaticmutation).
331Q -> H (in sporadic cancers; somaticmutation).
331Q -> P (in sporadic cancers; somaticmutation).
331Q -> R (in sporadic cancers; somaticmutation).
332I -> V (in a sporadic cancer; somaticmutation).
334G -> V (in sporadic cancers; somaticmutation).
334G -> W (in a sporadic cancer; somaticmutation).
335R -> G (in a sporadic cancer; somaticmutation).
335R -> H (in a sporadic cancer; somaticmutation).
335R -> L (in a sporadic cancer; somaticmutation).
337R -> C (in LFS; germline mutation and insporadic cancers; somatic mutation).
337R -> H (in LFS; germline mutation and insporadic cancers; somatic mutation).
337R -> L (in sporadic cancers; somaticmutation).
337R -> P (in sporadic cancers; somaticmutation).
338F -> I (in a sporadic cancer; somaticmutation).
338F -> L (in a sporadic cancer; somaticmutation).
339E -> K (in a sporadic cancer; somaticmutation; dbSNP:rs17882252).
339E -> Q (in a sporadic cancer; somaticmutation).
341F -> C (in sporadic cancers; somaticmutation).
342R -> L (in a sporadic cancer; somaticmutation).
342R -> P (in sporadic cancers; somaticmutation).
342R -> Q (in sporadic cancers; somaticmutation).
343E -> G (in sporadic cancers; somaticmutation).
344L -> P (in LFS; germline mutation and ina sporadic cancer; somatic mutation).
344L -> R (in a sporadic cancer; somaticmutation).
346E -> A (in a sporadic cancer; somaticmutation).
347A -> G (in a sporadic cancer; somaticmutation).
347A -> T (in sporadic cancers; somaticmutation).
348L -> F (in a sporadic cancer; somaticmutation).
348L -> S (in a sporadic cancer; somaticmutation).
349E -> D (in a sporadic cancer; somaticmutation).
352D -> H (in a sporadic cancer; somaticmutation).
353A -> T (in a sporadic cancer; somaticmutation).
354Q -> E (in a sporadic cancer; somaticmutation).
354Q -> K (in a sporadic cancer; somaticmutation).
354Q -> R (in sporadic cancers; somaticmutation).
356G -> A (in a sporadic cancer; somaticmutation).
356G -> W (in a sporadic cancer; somaticmutation).
358E -> D (in a sporadic cancer; somaticmutation).
358E -> K (in a sporadic cancer; somaticmutation).
360G -> A (in dbSNP:rs35993958). VAR_045562
360G -> V (in a sporadic cancer; somaticmutation).
363R -> K (in a sporadic cancer; somaticmutation).
364A -> P (in a sporadic cancer; somaticmutation).
364A -> T (in a sporadic cancer; somaticmutation).
364A -> V (in a sporadic cancer; somaticmutation).
365H -> R (in a sporadic cancer; somaticmutation).
365H -> Y (in a familial cancer not matchingLFS; germline mutation and in a sporadic
366S -> A (in a familial cancer not matchingLFS; germline mutation and in sporadic
370K -> Q (in a sporadic cancer; somaticmutation).
376S -> A (in a sporadic cancer; somaticmutation).
376S -> T (in a sporadic cancer; somaticmutation).
379R -> H (in sporadic cancers; somaticmutation).
385F -> L (in a sporadic cancer; somaticmutation).
389G -> W (in a sporadic cancer; somaticmutation).
392S -> L (in a sporadic cancer; somaticmutation).
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
6PhosphoserineEEPQSDPSV
CCCCCCCCC
63.30Phosphositeplus
Link-
6Phosphoserine (CSNK1A1)EEPQSDPSV
CCCCCCCCC
63.30HPRD
Link-
9PhosphoserineQSDPSVEPP
CCCCCCCCC
44.07PhosphoELM
Link-
9PhosphoserineQSDPSVEPP
CCCCCCCCC
44.07Phosphositeplus
Link-
9Phosphoserine (ATM)QSDPSVEPP
CCCCCCCCC
44.07HPRD
Link-
9Phosphoserine (CSNK1A1)QSDPSVEPP
CCCCCCCCC
44.07HPRD
Link-
9Phosphoserine; by HIPK4.QSDPSVEPP
CCCCCCCCC
44.07UniProtKB
Link-
15DePhosphoserineEPPLSQETF
CCCCCHHHH
31.57HPRD
Link-
15PhosphoserineEPPLSQETF
CCCCCHHHH
31.57HPRD
Link-
15PhosphoserineEPPLSQETF
CCCCCHHHH
31.57Phosphositeplus
Link-
15Phosphoserine (ATM)EPPLSQETF
CCCCCHHHH
31.57HPRD
Link-
15Phosphoserine (ATR)EPPLSQETF
CCCCCHHHH
31.57HPRD
Link-
15Phosphoserine (CHEK1)EPPLSQETF
CCCCCHHHH
31.57HPRD
Link-
15Phosphoserine (DNA-PK;ATM)EPPLSQETF
CCCCCHHHH
31.57PhosphoELM
Link-
15Phosphoserine (MAPK1)EPPLSQETF
CCCCCHHHH
31.57HPRD
Link-
15Phosphoserine (PRKDC)EPPLSQETF
CCCCCHHHH
31.57HPRD
Link-
15Phosphoserine; by CDK5, PRPK, AMPK, NUAK1and ATM.EPPLSQETF
CCCCCHHHH
31.57UniProtKB
Link-
18noneLSQETFSDL
CCHHHHHHH
22.32HPRD
Link-
18PhosphothreonineLSQETFSDL
CCHHHHHHH
22.32Phosphositeplus
Link-
18Phosphothreonine (ATR)LSQETFSDL
CCHHHHHHH
22.32HPRD
Link-
18Phosphothreonine (CK1_group;TTK;VRK1;VRK1)LSQETFSDL
CCHHHHHHH
22.32PhosphoELM
Link-
18Phosphothreonine (CSNK1D)LSQETFSDL
CCHHHHHHH
22.32HPRD
Link-
18Phosphothreonine (CSNK2A1)LSQETFSDL
CCHHHHHHH
22.32HPRD
Link-
18Phosphothreonine (CSNK2B)LSQETFSDL
CCHHHHHHH
22.32HPRD
Link-
18Phosphothreonine (PRKDC)LSQETFSDL
CCHHHHHHH
22.32HPRD
Link-
18Phosphothreonine (VRK1)LSQETFSDL
CCHHHHHHH
22.32HPRD
Link-
18Phosphothreonine; by CK1, VRK1 and VRK2.LSQETFSDL
CCHHHHHHH
22.32UniProtKB
Link-
20noneQETFSDLWK
HHHHHHHHH
38.93HPRD
Link-
20PhosphoserineQETFSDLWK
HHHHHHHHH
38.93Phosphositeplus
Link-
20Phosphoserine (ATM)QETFSDLWK
HHHHHHHHH
38.93HPRD
Link-
20Phosphoserine (ATR)QETFSDLWK
HHHHHHHHH
38.93HPRD
Link-
20Phosphoserine (CHEK1)QETFSDLWK
HHHHHHHHH
38.93HPRD
Link-
20Phosphoserine (CHK1;CHK2;DAPK1)QETFSDLWK
HHHHHHHHH
38.93PhosphoELM
Link-
20Phosphoserine (PLK3)QETFSDLWK
HHHHHHHHH
38.93HPRD
Link-
20Phosphoserine (PRKDC)QETFSDLWK
HHHHHHHHH
38.93HPRD
Link-
20Phosphoserine; by CHEK2, CK1 and PLK3.QETFSDLWK
HHHHHHHHH
38.93UniProtKB
Link-
23noneFSDLWKLLP
HHHHHHHCC
8.34HPRD
Link-
33PhosphoserineNNVLSPLPS
CCCCCCCCC
21.80HPRD
Link-
33PhosphoserineNNVLSPLPS
CCCCCCCCC
21.80Phosphositeplus
Link-
33Phosphoserine (ATM)NNVLSPLPS
CCCCCCCCC
21.80HPRD
Link-
33Phosphoserine (CDK5)NNVLSPLPS
CCCCCCCCC
21.80HPRD
Link-
33Phosphoserine (CDK9)NNVLSPLPS
CCCCCCCCC
21.80HPRD
Link-
33Phosphoserine (CDK_group;GSK-3_group;CDK7)NNVLSPLPS
CCCCCCCCC
21.80PhosphoELM
Link-
33Phosphoserine (GSK3B)NNVLSPLPS
CCCCCCCCC
21.80HPRD
Link-
33Phosphoserine (PRKDC)NNVLSPLPS
CCCCCCCCC
21.80HPRD
Link-
33Phosphoserine; by CDK5 and CDK7.NNVLSPLPS
CCCCCCCCC
21.80UniProtKB
Link-
37PhosphoserineSPLPSQAMD
CCCCCCCHH
37.95Phosphositeplus
Link-
37Phosphoserine (ATM)SPLPSQAMD
CCCCCCCHH
37.95HPRD
Link-
37Phosphoserine (ATR)SPLPSQAMD
CCCCCCCHH
37.95HPRD
Link-
37Phosphoserine (CHEK1)SPLPSQAMD
CCCCCCCHH
37.95HPRD
Link-
37Phosphoserine (DNA-PK;DNA-PK;DNA-PK;DNA-PK;MAPKAPK5)SPLPSQAMD
CCCCCCCHH
37.95PhosphoELM
Link-
37Phosphoserine (MAPKAPK5)SPLPSQAMD
CCCCCCCHH
37.95HPRD
Link-
37Phosphoserine (PRKDC)SPLPSQAMD
CCCCCCCHH
37.95HPRD
Link-
37Phosphoserine; by MAPKAPK5.SPLPSQAMD
CCCCCCCHH
37.95UniProtKB
Link-
46PhosphoserineDLMLSPDDI
HHHCCCHHH
16.59Phosphositeplus
Link-
46Phosphoserine (ATM)DLMLSPDDI
HHHCCCHHH
16.59HPRD
Link-
46Phosphoserine (ATM;DYRK2;DYRK2;HIPK2;HIPK2)DLMLSPDDI
HHHCCCHHH
16.59PhosphoELM
Link-
46Phosphoserine (HIPK2)DLMLSPDDI
HHHCCCHHH
16.59HPRD
Link-
46Phosphoserine; by CDK5, HIPK2 andPKC/PRKCG.DLMLSPDDI
HHHCCCHHH
16.59UniProtKB
Link-
55DePhosphothreonineEQWFTEDPG
HHHHCCCCC
36.20HPRD
Link-
55PhosphothreonineEQWFTEDPG
HHHHCCCCC
36.20Phosphositeplus
Link-
55Phosphothreonine (MAPK1)EQWFTEDPG
HHHHCCCCC
36.20HPRD
Link-
55Phosphothreonine (MAPK_group)EQWFTEDPG
HHHHCCCCC
36.20PhosphoELM
Link-
55Phosphothreonine; by TAF1 and GRK5.EQWFTEDPG
HHHHCCCCC
36.20UniProtKB
Link-
81PhosphothreoninePAAPTPAAP
CCCCCCCCC
22.34HPRD
Link-
81PhosphothreoninePAAPTPAAP
CCCCCCCCC
22.34Phosphositeplus
Link-
81Phosphothreonine (MAPK8)PAAPTPAAP
CCCCCCCCC
22.34HPRD
Link-
99PhosphoserineSSVPSQKTY
CCCCCCCCC
42.00HPRD
Link-
99PhosphoserineSSVPSQKTY
CCCCCCCCC
42.00PhosphoELM
Link-
99PhosphoserineSSVPSQKTY
CCCCCCCCC
42.00Phosphositeplus
Link-
99Phosphoserine.SSVPSQKTY
CCCCCCCCC
42.00UniProtKB
Link-
101Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VPSQKTYQG
CCCCCCCCC
54.24Phosphositeplus
Link-
1105-methylarginineSYGFRLGFL
CCCCEEEEC
29.55Phosphositeplus
Link-
115MethylhistidineLGFLHSGTA
EEECCCCCC
23.17Phosphositeplus
Link-
120Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SGTAKSVTC
CCCCCEEEE
45.34Phosphositeplus
Link-
120N6-acetyllysineSGTAKSVTC
CCCCCEEEE
45.34Phosphositeplus
Link-
132Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PALNKMFCQ
CHHHHHHHH
33.92Phosphositeplus
Link-
139Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)CQLAKTCPV
HHHCCCCCE
60.29Phosphositeplus
Link-
149O-linked (GlcNAc)LWVDSTPPP
EEECCCCCC
32.94Phosphositeplus
Link-
149PhosphoserineLWVDSTPPP
EEECCCCCC
32.94Phosphositeplus
Link-
150PhosphothreonineWVDSTPPPG
EECCCCCCC
35.04Phosphositeplus
Link-
155PhosphothreoninePPPGTRVRA
CCCCCEEEE
31.59Phosphositeplus
Link-
155Phosphothreonine (CSNK2A1)PPPGTRVRA
CCCCCEEEE
31.59HPRD
Link-
164Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)MAIYKQSQH
EHHHHHHHH
37.04Phosphositeplus
Link-
164N6-acetyllysineMAIYKQSQH
EHHHHHHHH
37.04Phosphositeplus
Link-
183PhosphoserineHERCSDSDG
CCCCCCCCC
46.50Phosphositeplus
Link-
183Phosphoserine; by AURKB.HERCSDSDG
CCCCCCCCC
46.50UniProtKB
Link-
2095-methylarginineYLDDRNTFR
EEECCCCCE
43.70Phosphositeplus
Link-
211PhosphothreonineDDRNTFRHS
ECCCCCEEE
23.96Phosphositeplus
Link-
2135-methylarginineRNTFRHSVV
CCCCEEEEE
21.09Phosphositeplus
Link-
215PhosphoserineTFRHSVVVP
CCEEEEEEC
16.61Phosphositeplus
Link-
215Phosphoserine (Aurora A)TFRHSVVVP
CCEEEEEEC
16.61PhosphoELM
Link-
269PhosphoserineLGRNSFEVR
EECEEEEEE
22.79Phosphositeplus
Link-
269Phosphoserine; by AURKB.LGRNSFEVR
EECEEEEEE
22.79UniProtKB
Link-
284PhosphothreonineRDRRTEEEN
CCCCCCHHH
48.95Phosphositeplus
Link-
284Phosphothreonine; by AURKB.RDRRTEEEN
CCCCCCHHH
48.95UniProtKB
Link-
291Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ENLRKKGEP
HHHHCCCCC
69.19Phosphositeplus
Link-
291Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin).ENLRKKGEP
HHHHCCCCC
69.19UniProtKB
Link-
292Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)NLRKKGEPH
HHHCCCCCC
63.17Phosphositeplus
Link-
292Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin).NLRKKGEPH
HHHCCCCCC
63.17UniProtKB
Link-
292N6-acetyllysineNLRKKGEPH
HHHCCCCCC
63.17HPRD
Link-
292N6-acetyllysineNLRKKGEPH
HHHCCCCCC
63.17Phosphositeplus
Link-
292N6-acetyllysine.NLRKKGEPH
HHHCCCCCC
63.17UniProtKB
Link-
305Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PGSTKRALP
CCCCCCCCC
37.05Phosphositeplus
Link-
305N6-acetyllysinePGSTKRALP
CCCCCCCCC
37.05HPRD
Link-
305N6-acetyllysinePGSTKRALP
CCCCCCCCC
37.05Phosphositeplus
Link-
305N6-acetyllysine.PGSTKRALP
CCCCCCCCC
37.05UniProtKB
Link-
312PhosphothreonineLPNNTSSSP
CCCCCCCCC
36.30Phosphositeplus
Link-
312PhosphothreonineLPNNTSSSP
CCCCCCCCC
36.30SysPTM
Link-
313PhosphoserinePNNTSSSPQ
CCCCCCCCC
30.83HPRD
Link-
313PhosphoserinePNNTSSSPQ
CCCCCCCCC
30.83Phosphositeplus
Link-
313PhosphoserinePNNTSSSPQ
CCCCCCCCC
30.83SysPTM
Link-
313Phosphoserine.PNNTSSSPQ
CCCCCCCCC
30.83UniProtKB
Link-
314PhosphoserineNNTSSSPQP
CCCCCCCCC
43.96HPRD
Link-
314PhosphoserineNNTSSSPQP
CCCCCCCCC
43.96Phosphositeplus
Link-
314PhosphoserineNNTSSSPQP
CCCCCCCCC
43.96SysPTM
Link-
314Phosphoserine.NNTSSSPQP
CCCCCCCCC
43.96UniProtKB
Link-
315DePhosphoserineNTSSSPQPK
CCCCCCCCC
27.59HPRD
Link-
315DePhosphoserineNTSSSPQPK
CCCCCCCCC
27.59HPRD
Link-
315PhosphoserineNTSSSPQPK
CCCCCCCCC
27.59HPRD
Link-
315PhosphoserineNTSSSPQPK
CCCCCCCCC
27.59Phosphositeplus
Link-
315PhosphoserineNTSSSPQPK
CCCCCCCCC
27.59SysPTM
Link-
315Phosphoserine (Aurora A)NTSSSPQPK
CCCCCCCCC
27.59PhosphoELM
Link-
315Phosphoserine (CDK2)NTSSSPQPK
CCCCCCCCC
27.59HPRD
Link-
315Phosphoserine (CDK5)NTSSSPQPK
CCCCCCCCC
27.59HPRD
Link-
315Phosphoserine (CDK9)NTSSSPQPK
CCCCCCCCC
27.59HPRD
Link-
315Phosphoserine; by AURKA, CDK1 and CDK2.NTSSSPQPK
CCCCCCCCC
27.59UniProtKB
Link-
319Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SPQPKKKPL
CCCCCCCCC
69.08HPRD
Link-
319Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SPQPKKKPL
CCCCCCCCC
69.08Phosphositeplus
Link-
319N6-acetyllysineSPQPKKKPL
CCCCCCCCC
69.08Phosphositeplus
Link-
320Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PQPKKKPLD
CCCCCCCCC
67.32HPRD
Link-
320Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PQPKKKPLD
CCCCCCCCC
67.32Phosphositeplus
Link-
320N6-acetyllysinePQPKKKPLD
CCCCCCCCC
67.32HPRD
Link-
320N6-acetyllysinePQPKKKPLD
CCCCCCCCC
67.32Phosphositeplus
Link-
320NeddyllysinePQPKKKPLD
CCCCCCCCC
67.32HPRD
Link-
320NeddyllysinePQPKKKPLD
CCCCCCCCC
67.32Phosphositeplus
Link-
321Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)QPKKKPLDG
CCCCCCCCC
57.87HPRD
Link-
321Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)QPKKKPLDG
CCCCCCCCC
57.87Phosphositeplus
Link-
321N6-acetyllysineQPKKKPLDG
CCCCCCCCC
57.87HPRD
Link-
321NeddyllysineQPKKKPLDG
CCCCCCCCC
57.87HPRD
Link-
321NeddyllysineQPKKKPLDG
CCCCCCCCC
57.87Phosphositeplus
Link-
3335-methylarginineTLQIRGRER
EEEEECCHH
25.75Phosphositeplus
Link
335N2,N2-dimethylarginineQIRGRERFE
EEECCHHHH
23.28Phosphositeplus
Link
337N2,N2-dimethylarginineRGRERFEMF
ECCHHHHHH
31.31Phosphositeplus
Link
351Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ALELKDAQA
HHHHHHCCC
41.46HPRD
Link
357Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AQAGKEPGG
CCCCCCCCC
64.85HPRD
Link-
357Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AQAGKEPGG
CCCCCCCCC
64.85Phosphositeplus
Link-
366PhosphoserineSRAHSSHLK
CCCCCCCCC
20.61HPRD
Link-
366PhosphoserineSRAHSSHLK
CCCCCCCCC
20.61Phosphositeplus
Link-
370Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SSHLKSKKG
CCCCCCCCC
55.60HPRD
Link-
370Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SSHLKSKKG
CCCCCCCCC
55.60Phosphositeplus
Link-
370N6,N6,N6-trimethyllysineSSHLKSKKG
CCCCCCCCC
55.60Phosphositeplus
Link-
370N6,N6-dimethyllysineSSHLKSKKG
CCCCCCCCC
55.60Phosphositeplus
Link-
370N6,N6-dimethyllysine; alternate.SSHLKSKKG
CCCCCCCCC
55.60UniProtKB
Link-
370N6-acetyllysineSSHLKSKKG
CCCCCCCCC
55.60HPRD
Link-
370N6-acetyllysineSSHLKSKKG
CCCCCCCCC
55.60Phosphositeplus
Link-
370N6-methylated lysineSSHLKSKKG
CCCCCCCCC
55.60HPRD
Link-
370N6-methyllysineSSHLKSKKG
CCCCCCCCC
55.60Phosphositeplus
Link-
370N6-methyllysine; by SMYD2; alternate.SSHLKSKKG
CCCCCCCCC
55.60UniProtKB
Link-
370NeddyllysineSSHLKSKKG
CCCCCCCCC
55.60HPRD
Link-
370NeddyllysineSSHLKSKKG
CCCCCCCCC
55.60Phosphositeplus
Link-
371PhosphoserineSHLKSKKGQ
CCCCCCCCC
46.06Phosphositeplus
Link-
371Phosphoserine (CDK7)SHLKSKKGQ
CCCCCCCCC
46.06PhosphoELM
Link-
371Phosphoserine (PRKCA)SHLKSKKGQ
CCCCCCCCC
46.06HPRD
Link-
372Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)HLKSKKGQS
CCCCCCCCC
60.37HPRD
Link-
372Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)HLKSKKGQS
CCCCCCCCC
60.37Phosphositeplus
Link-
372N6-acetyllysineHLKSKKGQS
CCCCCCCCC
60.37HPRD
Link-
372N6-acetyllysineHLKSKKGQS
CCCCCCCCC
60.37Phosphositeplus
Link-
372N6-methylated lysineHLKSKKGQS
CCCCCCCCC
60.37HPRD
Link-
372N6-methyllysineHLKSKKGQS
CCCCCCCCC
60.37MeMo
Link-
372N6-methyllysineHLKSKKGQS
CCCCCCCCC
60.37Phosphositeplus
Link-
372N6-methyllysine; by SETD7.HLKSKKGQS
CCCCCCCCC
60.37UniProtKB
Link-
372NeddyllysineHLKSKKGQS
CCCCCCCCC
60.37HPRD
Link-
372NeddyllysineHLKSKKGQS
CCCCCCCCC
60.37Phosphositeplus
Link-
373DeacetyllysineLKSKKGQST
CCCCCCCCC
70.08HPRD
Link-
373Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LKSKKGQST
CCCCCCCCC
70.08HPRD
Link-
373Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LKSKKGQST
CCCCCCCCC
70.08Phosphositeplus
Link-
373N6,N6-dimethyllysineLKSKKGQST
CCCCCCCCC
70.08Phosphositeplus
Link-
373N6,N6-dimethyllysine; by EHMT1 and EHMT2;alternate.LKSKKGQST
CCCCCCCCC
70.08UniProtKB
Link-
373N6-acetyllysineLKSKKGQST
CCCCCCCCC
70.08HPRD
Link-
373N6-acetyllysineLKSKKGQST
CCCCCCCCC
70.08Phosphositeplus
Link-
373N6-acetyllysine; alternate.LKSKKGQST
CCCCCCCCC
70.08UniProtKB
Link-
373N6-methyllysineLKSKKGQST
CCCCCCCCC
70.08Phosphositeplus
Link-
373NeddyllysineLKSKKGQST
CCCCCCCCC
70.08HPRD
Link-
373NeddyllysineLKSKKGQST
CCCCCCCCC
70.08Phosphositeplus
Link-
376PhosphoserineKKGQSTSRH
CCCCCCCCC
36.70Phosphositeplus
Link-
376Phosphoserine (CDK7)KKGQSTSRH
CCCCCCCCC
36.70PhosphoELM
Link-
377PhosphothreonineKGQSTSRHK
CCCCCCCCC
23.15Phosphositeplus
Link-
378PhosphoserineGQSTSRHKK
CCCCCCCCE
37.32Phosphositeplus
Link-
378Phosphoserine (CDK7)GQSTSRHKK
CCCCCCCCE
37.32PhosphoELM
Link-
378Phosphoserine (PRKCA)GQSTSRHKK
CCCCCCCCE
37.32HPRD
Link-
381Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TSRHKKLMF
CCCCCEEEE
46.63HPRD
Link-
381Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TSRHKKLMF
CCCCCEEEE
46.63Phosphositeplus
Link-
381N6-acetyllysineTSRHKKLMF
CCCCCEEEE
46.63HPRD
Link-
381N6-acetyllysineTSRHKKLMF
CCCCCEEEE
46.63Phosphositeplus
Link-
381N6-acetyllysine.TSRHKKLMF
CCCCCEEEE
46.63UniProtKB
Link-
381NeddyllysineTSRHKKLMF
CCCCCEEEE
46.63HPRD
Link-
382DeacetyllysineSRHKKLMFK
CCCCEEEEE
38.77HPRD
Link-
382DeacetyllysineSRHKKLMFK
CCCCEEEEE
38.77HPRD
Link-
382Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SRHKKLMFK
CCCCEEEEE
38.77Phosphositeplus
Link-
382N6,N6-dimethyllysineSRHKKLMFK
CCCCEEEEE
38.77Phosphositeplus
Link-
382N6-acetyllysineSRHKKLMFK
CCCCEEEEE
38.77HPRD
Link-
382N6-acetyllysineSRHKKLMFK
CCCCEEEEE
38.77Phosphositeplus
Link-
382N6-acetyllysine; alternate.SRHKKLMFK
CCCCEEEEE
38.77UniProtKB
Link-
382N6-methyllysineSRHKKLMFK
CCCCEEEEE
38.77Phosphositeplus
Link-
382N6-methyllysine; by SETD8; alternate.SRHKKLMFK
CCCCEEEEE
38.77UniProtKB
Link-
382NeddyllysineSRHKKLMFK
CCCCEEEEE
38.77HPRD
Link-
386Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)KLMFKTEGP
EEEEECCCC
31.53Phosphositeplus
Link-
386Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO).KLMFKTEGP
EEEEECCCC
31.53UniProtKB
Link-
386Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KLMFKTEGP
EEEEECCCC
31.53HPRD
Link-
386Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KLMFKTEGP
EEEEECCCC
31.53HPRD
Link-
386Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KLMFKTEGP
EEEEECCCC
31.53Phosphositeplus
Link-
386N6,N6-dimethyllysineKLMFKTEGP
EEEEECCCC
31.53Phosphositeplus
Link-
386N6-acetyllysineKLMFKTEGP
EEEEECCCC
31.53Phosphositeplus
Link-
386N6-methyllysineKLMFKTEGP
EEEEECCCC
31.53Phosphositeplus
Link-
386NeddyllysineKLMFKTEGP
EEEEECCCC
31.53HPRD
Link-
387PhosphothreonineLMFKTEGPD
EEEECCCCC
34.60Phosphositeplus
Link-
392PhosphoserineEGPDSD
CCCCCC
48.64Phosphositeplus
Link-
392Phosphoserine (CDK2)EGPDSD
CCCCCC
48.64HPRD
Link-
392Phosphoserine (CDK7)EGPDSD
CCCCCC
48.64PhosphoELM
Link-
392Phosphoserine (CDK9)EGPDSD
CCCCCC
48.64HPRD
Link-
392Phosphoserine (CSNK2A1)EGPDSD
CCCCCC
48.64HPRD
Link-
392Phosphoserine (EIF2AK2)EGPDSD
CCCCCC
48.64HPRD
Link-
392Phosphoserine (MAPK14)EGPDSD
CCCCCC
48.64HPRD
Link-
392Phosphoserine; by CK2, CDK2 and NUAK1.EGPDSD
CCCCCC
48.64UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
PSD11_HUMANphysical interactionMINT-63023MINT16169070
BHLH2_HUMANphysical interactionMINT-4544983MINT17347673
BHLH2_HUMANdirect interactionMINT-4654062MINT17347673
BHLH2_HUMANcolocalizationMINT-4544966MINT17347673
DVL2_HUMANphysical interactionMINT-67597MINT16189514
DVL2_HUMANphysical interactionMINT-2858243MINT16713569
XPO1_HUMANphysical interactionMINT-4303978MINT17268548
MDM4_HUMANdirect interactionMINT-2517887MINT15604276
P73_HUMANphysical interactionMINT-14181MINT11238924
P73_HUMANphysical interactionMINT-16482MINT11238924
P73_HUMANphysical interactionMINT-16611MINT9891077
LEU1_HUMANphysical interactionMINT-63114MINT16169070
HNRL1_HUMANphysical interactionMINT-58673MINT15907477
HNRL1_HUMANphysical interactionMINT-58674MINT15907477
HNRL1_HUMANphysical interactionMINT-58675MINT15907477
ARI2_HUMANphysical interactionMINT-63290MINT16169070
CHK2_HUMANphosphorylation reactionMINT-58603MINT15862297
PNPH_HUMANphysical interactionMINT-63335MINT16169070
ABL1_HUMANphysical interactionMINT-13952MINT8900110
ESR1_HUMANphysical interactionMINT-15398MINT10766163
GCR_HUMANphysical interactionMINT-16857MINT11080152
GCR_HUMANphysical interactionMINT-17484MINT11562347
KITH_HUMANphysical interactionMINT-63365MINT16169070
S10A8_HUMANphysical interactionMINT-63391MINT16169070
NPM_HUMANphysical interactionMINT-74887MINT16376884
SP1_HUMANphysical interactionMINT-56524MINT15710382
SP1_HUMANphysical interactionMINT-56525MINT15710382
SP1_HUMANphysical interactionMINT-13645MINT9492043
HS90B_HUMANphysical interactionMINT-16632MINT11707401
HS90B_HUMANphysical interactionMINT-16633MINT11707401
HMGB1_HUMANphysical interactionMINT-17985MINT11106654
HMGB1_HUMANphysical interactionMINT-16023MINT9472015
PARP1_HUMANphysical interactionMINT-16978MINT12898523
PARP1_HUMANphysical interactionMINT-16977MINT12898523
BCL2_HUMANphysical interactionMINT-16291MINT12667443
BCL2_HUMANphysical interactionMINT-16292MINT12667443
ANXA3_HUMANphysical interactionMINT-63460MINT16169070
EGR1_HUMANcolocalizationMINT-4793180MINT14744935
IF2B_HUMANphysical interactionMINT-63537MINT16169070
SAT1_HUMANphysical interactionMINT-63559MINT16169070
PML_HUMANphysical interactionMINT-4793478MINT12915590
PML_HUMANdirect interactionMINT-4793489MINT12915590
2AAA_HUMANphysical interactionMINT-4299110MINT17245430
HS71L_HUMANphysical interactionMINT-4302642MINT17184779
ARL3_HUMANphysical interactionMINT-63694MINT16169070
BRCA1_HUMANphysical interactionMINT-16162MINT9926942
BRCA1_HUMANphysical interactionMINT-15525MINT9926942
BRCA1_HUMANphysical interactionMINT-16161MINT9926942
BRCA1_HUMANphysical interactionMINT-16574MINT9926942
GRP75_HUMANphysical interactionMINT-4302632MINT17184779
CDN1A_HUMANcolocalizationMINT-1891378MINT16616141
CDN2C_HUMANphysical interactionMINT-63749MINT16169070
TCPE_HUMANphysical interactionMINT-63773MINT16169070
PRI1_HUMANphysical interactionMINT-14180MINT11917009
GSK3B_HUMANphosphorylation reactionMINT-4793253MINT14744935
ST1E1_HUMANphysical interactionMINT-63800MINT16169070
SPB9_HUMANphysical interactionMINT-63814MINT16169070
BMX_HUMANphysical interactionMINT-68565MINT16186805
IMA2_HUMANphysical interactionMINT-16972MINT10930427
PLK1_HUMANphysical interactionMINT-2634858MINT16753148
ELL_HUMANphysical interactionMINT-14768MINT8016121
ELL_HUMANphysical interactionMINT-14769MINT8016121
ELL_HUMANphysical interactionMINT-14770MINT8016121
ELL_HUMANphysical interactionMINT-14771MINT8016121
PP1A_HUMANphysical interactionMINT-62206MINT15231748
UBIQ_HUMANphysical interactionMINT-4054804MINT17159902
1433Z_HUMANphysical interactionMINT-74925MINT16376338
MDM2_HUMANphysical interactionMINT-4793467MINT12915590
MDM2_HUMANdirect interactionMINT-4793511MINT12915590
MDM2_HUMANphysical interactionMINT-58465MINT15848166
MDM2_HUMANphysical interactionMINT-58468MINT15848166
MDM2_HUMANphysical interactionMINT-68743MINT16212962
MDM2_HUMANphysical interactionMINT-4303990MINT17268548
MDM2_HUMANphysical interactionMINT-4545014MINT17347673
MDM2_HUMANphysical interactionMINT-4049616MINT17139261
MDM2_HUMANphysical interactionMINT-4054304MINT17159902
MDM2_HUMANphysical interactionMINT-14815MINT9278461
MDM2_HUMANphysical interactionMINT-4049631MINT17139261
MDM2_HUMANphysical interactionMINT-16314MINT10766163
MDM2_HUMANphysical interactionMINT-15058MINT11562347
MDM2_HUMANphysical interactionMINT-56681MINT14704432
MDM2_HUMANubiquitination reactionMINT-14981MINT8875929
GSTM4_HUMANphysical interactionMINT-64041MINT16169070
TP53B_HUMANphysical interactionMINT-15636MINT8016121
TP53B_HUMANphysical interactionMINT-17773MINT8016121
TP53B_HUMANphysical interactionMINT-15637MINT8016121
TP53B_HUMANphysical interactionMINT-17772MINT8016121
TP53B_HUMANphysical interactionMINT-17771MINT8016121
ATM_HUMANphosphorylation reactionMINT-49767MINT10864201
2A5G_HUMANphysical interactionMINT-4299201MINT17245430
PIN1_HUMANphysical interactionMINT-19991MINT12397362
PIN1_HUMANphysical interactionMINT-19990MINT12397362
ASPP2_HUMANphysical interactionMINT-15809MINT8016121
ASPP2_HUMANphysical interactionMINT-15810MINT8016121
RGRF1_HUMANphysical interactionMINT-2634790MINT16753148
COX17_HUMANphysical interactionMINT-64164MINT16169070
PA1B3_HUMANphysical interactionMINT-64202MINT16169070
GUSL2_HUMANphysical interactionMINT-64247MINT16169070
MED1_HUMANphysical interactionMINT-58467MINT15848166
Q6ZSW6_HUMANphysical interactionMINT-64729MINT16169070
Q75MW1_HUMANphysical interactionMINT-64748MINT16169070
Q7Z566_HUMANphysical interactionMINT-64773MINT16169070
SYVN1_HUMANphysical interactionMINT-4052156MINT17170702
SYVN1_HUMANphysical interactionMINT-4052176MINT17170702
SYVN1_HUMANphysical interactionMINT-4052135MINT17170702
SYVN1_HUMANdirect interactionMINT-4052116MINT17170702
SYVN1_HUMANcolocalizationMINT-4052187MINT17170702
THAP8_HUMANphysical interactionMINT-64946MINT16169070
RFWD2_HUMANphysical interactionMINT-49845MINT15103385
RFWD2_HUMANphysical interactionMINT-49844MINT15103385
RFWD2_HUMANphysical interactionMINT-49846MINT15103385
UBP7_HUMANphysical interactionMINT-4304022MINT17268548
UBP7_HUMANphysical interactionMINT-15877MINT11923872
UBP7_HUMAN204(deubiquitination reactionMINT-14904MINT11923872
UBP7_HUMAN204(deubiquitination reactionMINT-15878MINT11923872
UBP7_HUMANphysical interactionMINT-15876MINT11923872
Q96EI7_HUMANphysical interactionMINT-65132MINT16169070
MAGBI_HUMANphysical interactionMINT-66234MINT16189514
MAGBI_HUMANphysical interactionMINT-2879329MINT16713569
ZN363_HUMANphysical interactionMINT-5114653MINT17568776
ZN363_HUMANphysical interactionMINT-5114708MINT17568776
ZN363_HUMANphysical interactionMINT-5114627MINT17568776
ZN363_HUMANdirect interactionMINT-5114673MINT17568776
ZN363_HUMANcolocalizationMINT-5114724MINT17568776
BTBD2_HUMANphysical interactionMINT-65379MINT16169070
P63_HUMANphysical interactionMINT-15119MINT11238924
P63_HUMANphysical interactionMINT-15262MINT11238924
P63_HUMANphysical interactionMINT-15300MINT11238924
P63_HUMANphysical interactionMINT-15468MINT11238924
P63_HUMANphysical interactionMINT-16037MINT11238924
P63_HUMANphysical interactionMINT-16239MINT11238924
P63_HUMANphysical interactionMINT-16384MINT11238924
P63_HUMANphysical interactionMINT-16985MINT11238924
TOPRS_HUMANphysical interactionMINT-4329805MINT17290218
WWOX_HUMANphysical interactionMINT-61311MINT15580310
WWOX_HUMANphysical interactionMINT-61314MINT15580310
WWOX_HUMANphysical interactionMINT-61316MINT15580310
WWOX_HUMANphysical interactionMINT-61317MINT15580310
DAXX_HUMANphysical interactionMINT-19255MINT12954772
DAXX_HUMANphysical interactionMINT-19257MINT12954772
DAXX_HUMANphysical interactionMINT-19256MINT12954772
TAF9_HUMANphysical interaction
physical interaction
DIP:194EDIP11278372
7809597
MDM2_HUMANphysical interaction
physical interaction
physical interaction
physical interaction
physical interaction
physical interaction
physical interaction
physical interaction
physica
DIP:40081EDIP10321734
10608892
10321734
9529249
12529318
11278372
10321734
11223036
11070080
BRCA2_HUMANphysical interactionDIP:40109EDIP9811893
TP53B_HUMANphysical interaction
physical interaction
physical interaction
DIP:40135EDIP11877378
12110597
8016121
ASPP2_HUMANphysical interaction
physical interaction
physical interaction
physical interaction
physical interaction
DIP:40139EDIP8668206
8016121
8668206
8668206
8668206
CD2A2_HUMANphysical interaction
physical interaction
DIP:40161EDIP9724636
12640129
UBIQ_HUMANphysical interactionDIP:40165EDIP12640129
RFA1_HUMANphysical interactionDIP:40181EDIP8663296
P53_HUMANphysical interactionDIP:40194EDIP11254385
HMGB1_HUMANphysical interaction
physical interaction
DIP:40072EDIP9472015
9472015
SETD7_HUMANdirect interactionDIP:57051EDIP16415881
UBP7_HUMANdirect interaction
direct interaction
direct interaction
direct interaction
direct interaction
direct interaction
DIP:57057EDIP16402859
16402859
16474402
16474402
16474402
16474402
SETD7_HUMANdirect interaction
direct interaction
direct interaction
direct interaction
methylation
EBI-1270379
EBI-1270353
EBI-1
intact15525938
15525938
15525938
15525938
16415881
EZH2_HUMANphysical interaction
physical interaction
physical interaction
EBI-1264956
EBI-1264937
EBI-1
intact17560333
17560333
17560333
Z385A_HUMANphysical interactionEBI-1539817
intact17719541
MDM4_HUMANphysical interaction
physical interaction
physical interaction
EBI-1540065
EBI-1540273
EBI-1
intact17875722
17875722
17875722
SIN3A_HUMANphysical interaction
physical interaction
EBI-493181
EBI-493242
intact10823891
11359905
HD_HUMANphysical interaction
physical interaction
physical interaction
physical interaction
EBI-492998
EBI-493068
EBI-493
intact10823891
10823891
10823891
10823891
WRN_HUMANdirect interaction
direct interaction
colocalization
direct interaction
direct interaction
EBI-708435
EBI-708448
EBI-708
intact11427532
11427532
11427532
15735006
15735006
CABL1_HUMANphysical interactionEBI-604641
intact11706030
GNL3_HUMANphysical interactionEBI-641720
intact12464630
HIPK1_HUMANphysical interaction
physical interaction
EBI-692933
EBI-692887
intact12702766
12702766
HUWE1_HUMANphysical interaction
physical interaction
physical interaction
EBI-626197
EBI-626167
EBI-626
intact15989956
15989956
15989956
PCDA4_HUMANphysical interactionEBI-729123
intact16169070
K0087_HUMANphysical interactionEBI-734908
intact16169070
BMX_HUMANphysical interactionEBI-847661
intact16186805
MAGBI_HUMANphysical interaction
physical interaction
EBI-753139
EBI-956110
intact16189514
16713569
EP300_HUMANphysical interaction
physical interaction
EBI-493328
EBI-866432
intact9194564
10518217
Q8N9B5_HUMANphysical interactionEBI-866445
intact10518217
PIAS4_HUMANphysical interaction
physical interaction
EBI-1153708
EBI-1153677
intact11388671
11388671
TP53B_HUMANdirect interactionEBI-1033085
intact11877378
ATR_HUMANphosphorylationEBI-969043
intact16293623
UBP7_HUMANphysical interaction
physical interaction
physical interaction
physical interaction
physical interaction
direct interaction
physical inter
EBI-996406
EBI-996378
EBI-996
intact16474402
16474402
16474402
16474402
16474402
16474402
16845383
16845383
16845383
NFYB_HUMANphysical interaction
physical interaction
physical interaction
physical interaction
physical interaction
EBI-1025792
EBI-1040859
EBI-1
intact16959611
16959611
16959611
16959611
16959611
NFYA_HUMANphysical interaction
physical interaction
physical interaction
physical interaction
physical interaction
physical interaction
colocalizati
EBI-1025792
EBI-1036989
EBI-1
intact16959611
16959611
16959611
16959611
16959611
16959611
16959611
16959611
16959611
16959611
16959611
PCAF_HUMANphysical interaction
physical interaction
EBI-1036989
EBI-1028948
intact16959611
16959611
HDAC1_HUMANphysical interaction
physical interaction
physical interaction
EBI-1029612
EBI-1029255
EBI-1
intact16959611
16959611
16959611
ASPP2_HUMANdirect interactionEBI-1026207
intact8875926
RAD51_HUMANphysical interaction
physical interaction
EBI-367003
EBI-367053
intact9380510
9380510
P53_HUMANphysical interactionEBI-1368406
intact17612295
PML_HUMANin vitro
in vivo
HPRD:01859HPRD11704853
11025664
11080164
ACTS_HUMANin vitroHPRD:01859HPRD11821948
AP2A_HUMANin vitro
in vivo
yeast 2-hybrid
HPRD:01859HPRD12226108
APEX1_HUMANin vivoHPRD:01859HPRD9119221
MDM2_HUMANin vitro
in vivo
HPRD:01859HPRD16432196
12842086
9278461
BRCA1_HUMANin vitro
in vivo
HPRD:01859HPRD9482880
9926942
CDC2_HUMANin vitro
in vivo
HPRD:01859HPRD11327730
CR2_HUMANin vitroHPRD:01859HPRD7753047
CCNA2_HUMANin vitroHPRD:01859HPRD10884347
TOP1_HUMANin vitro
in vivo
HPRD:01859HPRD10468612
8639538
TOP2A_HUMANin vitro
in vivo
HPRD:01859HPRD10666337
TOP2B_HUMANin vitro
in vivo
HPRD:01859HPRD10666337
EF2_HUMANin vivoHPRD:01859HPRD12891704
EGR1_HUMANin vitro
in vivo
HPRD:01859HPRD11251186
ESR1_HUMANin vitroHPRD:01859HPRD10766163
ERCC3_HUMANin vitroHPRD:01859HPRD7663514
ERCC6_HUMANin vitro
in vivo
HPRD:01859HPRD10882116
GCR_HUMANin vitro
in vivo
HPRD:01859HPRD11080152
HS90A_HUMANin vivoHPRD:01859HPRD11507088
12427754
HD_HUMANin vitro
in vivo
HPRD:01859HPRD10823891
IF16_HUMANin vivoHPRD:01859HPRD11146555
PARP1_HUMANin vitro
in vivo
HPRD:01859HPRD9565608
12898523
BCL2_HUMANin vitro
in vivo
HPRD:01859HPRD12667443
PHB_HUMANin vitro
in vivo
HPRD:01859HPRD14500729
HMGB1_HUMANin vitro
in vivo
HPRD:01859HPRD9472015
11106654
11748221
HMGB2_HUMANin vitroHPRD:01859HPRD11748232
IKBA_HUMANin vivo
yeast 2-hybrid
HPRD:01859HPRD11799106
YBOX1_HUMANin vitro
in vivo
HPRD:01859HPRD11175333
11973333
MPIP3_HUMANin vitro
in vivo
HPRD:01859HPRD10853038
16753148
NUCL_HUMANin vitro
in vivo
HPRD:01859HPRD12138209
NPM_HUMANin vitro
in vivo
HPRD:01859HPRD12080348
SSR3_HUMANin vivoHPRD:01859HPRD8961277
S100B_HUMANin vitroHPRD:01859HPRD11527429
10876243
P53_HUMANin vitro
in vivo
yeast 2-hybrid
HPRD:01859HPRD12419336
9628871
15383276
11080164
11842245
10415337
8816502
11950834
8921390
11748221
14519663
1219
S10A4_HUMANin vitroHPRD:01859HPRD11527429
15116098
12942774
11278647
RAD51_HUMANin vitro
in vivo
HPRD:01859HPRD9380510
8617246
TFDP1_HUMANin vitro
in vivo
HPRD:01859HPRD8816502
RFA1_HUMANin vitro
in vivo
HPRD:01859HPRD11751427
8361542
E2F1_HUMANin vitro
in vivo
HPRD:01859HPRD11739724
RIR2_HUMANin vivoHPRD:01859HPRD12615712
TF2H1_HUMANin vitroHPRD:01859HPRD7935417
ABL1_HUMANin vitro
in vivo
HPRD:01859HPRD10713716
10629029
KU70_HUMANin vivoHPRD:01859HPRD15782130
ZNF24_HUMANyeast 2-hybridHPRD:01859HPRD16169070
SAT1_HUMANyeast 2-hybridHPRD:01859HPRD16169070
LAMA4_HUMANyeast 2-hybridHPRD:01859HPRD16169070
SPB9_HUMANyeast 2-hybridHPRD:01859HPRD16169070
DVL2_HUMANyeast 2-hybridHPRD:01859HPRD16189514
16713569
PA1B3_HUMANyeast 2-hybridHPRD:01859HPRD16169070
STX5_HUMANyeast 2-hybridHPRD:01859HPRD16169070
CDN2C_HUMANyeast 2-hybridHPRD:01859HPRD16169070
CCL18_HUMANyeast 2-hybridHPRD:01859HPRD16169070
IF2B_HUMANyeast 2-hybridHPRD:01859HPRD16169070
PSD11_HUMANyeast 2-hybridHPRD:01859HPRD16169070
ARL3_HUMANyeast 2-hybridHPRD:01859HPRD16169070
COX17_HUMANyeast 2-hybridHPRD:01859HPRD16169070
TCPE_HUMANyeast 2-hybridHPRD:01859HPRD16169070
MAGBI_HUMANyeast 2-hybridHPRD:01859HPRD16189514
16713569
PCDA4_HUMANyeast 2-hybridHPRD:01859HPRD16169070
ST1E1_HUMANyeast 2-hybridHPRD:01859HPRD16169070
ERH_HUMANyeast 2-hybridHPRD:01859HPRD16169070
HSPB1_HUMANyeast 2-hybridHPRD:01859HPRD16169070
ARI2_HUMANyeast 2-hybridHPRD:01859HPRD16169070
FXYD6_HUMANyeast 2-hybridHPRD:01859HPRD16169070
MD2BP_HUMANyeast 2-hybridHPRD:01859HPRD16169070
WDR33_HUMANyeast 2-hybridHPRD:01859HPRD16169070
BTBD2_HUMANyeast 2-hybridHPRD:01859HPRD16169070
MPH6_HUMANyeast 2-hybridHPRD:01859HPRD16169070
CD40L_HUMANin vivoHPRD:01859HPRD12011072
SMAD2_HUMANin vitro
in vivo
HPRD:01859HPRD12732139
SMAD3_HUMANin vitro
in vivo
HPRD:01859HPRD12732139
SP1_HUMANin vitro
in vivo
HPRD:01859HPRD9492043
15790310
SCAM1_HUMANyeast 2-hybridHPRD:01859HPRD16713569
PP1A_HUMANyeast 2-hybridHPRD:01859HPRD15231748
SP3_HUMANin vitro
in vivo
HPRD:01859HPRD15790310
CC106_HUMANyeast 2-hybridHPRD:01859HPRD16169070
CP024_HUMANyeast 2-hybridHPRD:01859HPRD16169070
THAP8_HUMANyeast 2-hybridHPRD:01859HPRD16169070
ZCH10_HUMANyeast 2-hybridHPRD:01859HPRD16169070
TIP60_HUMANin vivoHPRD:01859HPRD16601686
PLK1_HUMANin vivo
yeast 2-hybrid
HPRD:01859HPRD16753148
TNR1A_HUMANENSP00000269305STRING
PR15A_HUMANENSP00000269305STRING
PR15A_HUMANENSP00000269305STRING
PR15A_HUMANENSP00000269305STRING
MAPK5_HUMANENSP00000269305STRING
ESR1_HUMANENSP00000269305STRING
SIRT1_HUMANENSP00000269305STRING
MK01_HUMANENSP00000269305STRING
VRK1_HUMANENSP00000269305STRING
APEX1_HUMANENSP00000269305STRING
IKBA_HUMANENSP00000269305STRING
TAF9_HUMANENSP00000269305STRING
MMP2_HUMANENSP00000269305STRING
GML_HUMANENSP00000269305STRING
TR10A_HUMANENSP00000269305STRING
KCRM_HUMANENSP00000269305STRING
ERCC2_HUMANENSP00000269305STRING
HXA5_HUMANENSP00000269305STRING
PAI1_HUMANENSP00000269305STRING
BAG1_HUMANENSP00000269305STRING
CD82_HUMANENSP00000269305STRING
HSP7C_HUMANENSP00000269305STRING
CCND1_HUMANENSP00000269305STRING
CDN1B_HUMANENSP00000269305STRING
IFNG_HUMANENSP00000269305STRING
TBP_HUMANENSP00000269305STRING
MLH1_HUMANENSP00000269305STRING
E2AK2_HUMANENSP00000269305STRING
E2AK2_HUMANENSP00000269305STRING
MSH2_HUMANENSP00000269305STRING
CEBPZ_HUMANENSP00000269305STRING
EGR1_HUMANENSP00000269305STRING
TBX2_HUMANENSP00000269305STRING
TWST1_HUMANENSP00000269305STRING
CDN1A_HUMANENSP00000269305STRING
IRF1_HUMANENSP00000269305STRING
PIN1_HUMANENSP00000269305STRING
PIN1_HUMANENSP00000269305STRING
HSPB1_HUMANENSP00000269305STRING
PIAS1_HUMANENSP00000269305STRING
NEDD8_HUMANENSP00000269305STRING
INS_HUMANENSP00000269305STRING
INS_HUMANENSP00000269305STRING
RIR2B_HUMANENSP00000269305STRING
RAF1_HUMANENSP00000269305STRING
TS101_HUMANENSP00000269305STRING
PARC_HUMANENSP00000269305STRING
GDF15_HUMANENSP00000269305STRING
NR1H2_HUMANENSP00000269305STRING
DNJB1_HUMANENSP00000269305STRING
RFA1_HUMANENSP00000269305STRING
RASK_HUMANENSP00000269305STRING
CCNB1_HUMANENSP00000269305STRING
CDK7_HUMANENSP00000269305STRING
CCNH_HUMANENSP00000269305STRING
CABL1_HUMANENSP00000269305STRING
DDB2_HUMANENSP00000269305STRING
CDK4_HUMANENSP00000269305STRING
MDM2_HUMANENSP00000269305STRING
IL6_HUMANENSP00000269305STRING
NMT1_HUMANENSP00000269305STRING
MDC1_HUMANENSP00000269305STRING
CASP1_HUMANENSP00000269305STRING
TSP1_HUMANENSP00000269305STRING
BARD1_HUMANENSP00000269305STRING
MAT1_HUMANENSP00000269305STRING
TYY1_HUMANENSP00000269305STRING
CBP_HUMANENSP00000269305STRING
DNJA3_HUMANENSP00000269305STRING
HUWE1_HUMANENSP00000269305STRING
PIAS4_HUMANENSP00000269305STRING
MK03_HUMANENSP00000269305STRING
EP300_HUMANENSP00000269305STRING
HNRL1_HUMANENSP00000269305STRING
HIPK2_HUMANENSP00000269305STRING
ARI3A_HUMANENSP00000269305STRING
ARI3A_HUMANENSP00000269305STRING
ARI3A_HUMANENSP00000269305STRING
PCAF_HUMANENSP00000269305STRING
TP53B_HUMANENSP00000269305STRING
TNR8_HUMANENSP00000269305STRING
ELAV1_HUMANENSP00000269305STRING
SUMO1_HUMANENSP00000269305STRING
THA_HUMANENSP00000269305STRING
STAT3_HUMANENSP00000269305STRING
ICAM1_HUMANENSP00000269305STRING
CUL7_HUMANENSP00000269305STRING
PERP_HUMANENSP00000269305STRING
CHKA_HUMANENSP00000269305STRING
MDR1_HUMANENSP00000269305STRING
DAXX_HUMANENSP00000269305STRING
TIMP3_HUMANENSP00000269305STRING
CDK2_HUMANENSP00000269305STRING
RB_HUMANENSP00000269305STRING
RAD51_HUMANENSP00000269305STRING
IGF1R_HUMANENSP00000269305STRING
PML_HUMANENSP00000269305STRING
ERBB2_HUMANENSP00000269305STRING
CCNA2_HUMANENSP00000269305STRING
EGFR_HUMANENSP00000269305STRING
LYN_HUMANENSP00000269305STRING
ATM_HUMANENSP00000269305STRING
EI24_HUMANENSP00000269305STRING
CHK1_HUMANENSP00000269305STRING
CABL2_HUMANENSP00000269305STRING
THB_HUMANENSP00000269305STRING
XPC_HUMANENSP00000269305STRING
ERCC3_HUMANENSP00000269305STRING
BANP_HUMANENSP00000269305STRING
AIFM1_HUMANENSP00000269305STRING
BUB1B_HUMANENSP00000269305STRING
DUS2_HUMANENSP00000269305STRING
FANCC_HUMANENSP00000269305STRING
FABD_HUMANENSP00000269305STRING
BTG2_HUMANENSP00000269305STRING
S100B_HUMANENSP00000269305STRING
BAX_HUMANENSP00000269305STRING
K2C8_HUMANENSP00000269305STRING
K2C8_HUMANENSP00000269305STRING
MSX1_HUMANENSP00000269305STRING
TGFA_HUMANENSP00000269305STRING
IF16_HUMANENSP00000269305STRING
PARPT_HUMANENSP00000269305STRING
NPM_HUMANENSP00000269305STRING
GRP75_HUMANENSP00000269305STRING
CDK5_HUMANENSP00000269305STRING
WRN_HUMANENSP00000269305STRING
PLK1_HUMANENSP00000269305STRING
PHB_HUMANENSP00000269305STRING
MED1_HUMANENSP00000269305STRING
MED1_HUMANENSP00000269305STRING
MED1_HUMANENSP00000269305STRING
PRDX2_HUMANENSP00000269305STRING
MGMT_HUMANENSP00000269305STRING
BCLX_HUMANENSP00000269305STRING
RIR2_HUMANENSP00000269305STRING
HSP74_HUMANENSP00000269305STRING
CDC2_HUMANENSP00000269305STRING
SNURF_HUMANENSP00000269305STRING
FOS_HUMANENSP00000269305STRING
PPM1D_HUMANENSP00000269305STRING
TAD3L_HUMANENSP00000269305STRING
CYC_HUMANENSP00000269305STRING
CYC_HUMANENSP00000269305STRING
EF2_HUMANENSP00000269305STRING
RASH_HUMANENSP00000269305STRING
TR10D_HUMANENSP00000269305STRING
CASP3_HUMANENSP00000269305STRING
RAD9A_HUMANENSP00000269305STRING
CASP2_HUMANENSP00000269305STRING
IKBB_HUMANENSP00000269305STRING
BAI1_HUMANENSP00000269305STRING
PRKDC_HUMANENSP00000269305STRING
HIC1_HUMANENSP00000269305STRING
RPRM_HUMANENSP00000269305STRING
AL2S8_HUMANENSP00000269305STRING
VEGFA_HUMANENSP00000269305STRING
NUCL_HUMANENSP00000269305STRING
NQO1_HUMANENSP00000269305STRING
STK6_HUMANENSP00000269305STRING
MPIP3_HUMANENSP00000269305STRING
ING5_HUMANENSP00000269305STRING
KC1D_HUMANENSP00000269305STRING
ETS1_HUMANENSP00000269305STRING
STK11_HUMANENSP00000269305STRING
MRE11_HUMANENSP00000269305STRING
PEG3_HUMANENSP00000269305STRING
CHK2_HUMANENSP00000269305STRING
SP1_HUMANENSP00000269305STRING
CASP9_HUMANENSP00000269305STRING
WT1_HUMANENSP00000269305STRING
MK11_HUMANENSP00000269305STRING
HS90A_HUMANENSP00000269305STRING
HS90A_HUMANENSP00000269305STRING
HS90A_HUMANENSP00000269305STRING
NDKA_HUMANENSP00000269305STRING
QORX_HUMANENSP00000269305STRING
HIF1A_HUMANENSP00000269305STRING
HIF1A_HUMANENSP00000269305STRING
FOXO3_HUMANENSP00000269305STRING
FAK1_HUMANENSP00000269305STRING
UBP7_HUMANENSP00000269305STRING
ATR_HUMANENSP00000269305STRING
T53I1_HUMANENSP00000269305STRING
FHL2_HUMANENSP00000269305STRING
ATF3_HUMANENSP00000269305STRING
PTTG1_HUMANENSP00000269305STRING
PTTG2_HUMANENSP00000269305STRING
HMGB1_HUMANENSP00000269305STRING
E2F1_HUMANENSP00000269305STRING
S10A4_HUMANENSP00000269305STRING
HD_HUMANENSP00000269305STRING
BLM_HUMANENSP00000269305STRING
TNR6_HUMANENSP00000269305STRING
UBC9_HUMANENSP00000269305STRING
IGF2_HUMANENSP00000269305STRING
SIAH1_HUMANENSP00000269305STRING
SIAH1_HUMANENSP00000269305STRING
BIM_HUMANENSP00000269305STRING
NF1_HUMANENSP00000269305STRING
CASP8_HUMANENSP00000269305STRING
NTRK1_HUMANENSP00000269305STRING
MK10_HUMANENSP00000269305STRING
KU70_HUMANENSP00000269305STRING
KU70_HUMANENSP00000269305STRING
HRX_HUMANENSP00000269305STRING
BBC3_HUMANENSP00000269305STRING
APAF_HUMANENSP00000269305STRING
MK08_HUMANENSP00000269305STRING
ASPP2_HUMANENSP00000269305STRING
TOPRS_HUMANENSP00000269305STRING
ZN148_HUMANENSP00000269305STRING
STAT1_HUMANENSP00000269305STRING
STAT1_HUMANENSP00000269305STRING
TOP1_HUMANENSP00000269305STRING
- top -

Disease Reference
Kegg disease
OMIM disease
Note=TP53 is found in increased amounts in a wide variety of transformed cells. TP53 is frequently mutated or inactivated in about 60% of cancers. TP53 defects are found in Barrett metaplasia a condition in which the normally stratified squamous epithelium of the lower esophagus is replaced by a metaplastic columnar epithelium. The condition develops as a complication in approximately 10% of patients with chronic gastroesophageal reflux disease and predisposes to the development of esophageal adenocarcinoma.
133239
151623Li-Fraumeni syndrome (LFS)
275355Squamous cell carcinoma of the head and neck (HNSCC)
211980Lung cancer (LNCR)
260500Papilloma of choroid plexus (CPP)
202300Adrenocortical carcinoma (ADCC)
614740Basal cell carcinoma 7 (BCC7)
Drug Reference
DrugBank
DB00945Acetylsalicylic acid
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-292; LYS-305; LYS-381 ANDLYS-382, AND MASS SPECTROMETRY.
"BRD7 is a candidate tumour suppressor gene required for p53function.";
Drost J., Mantovani F., Tocco F., Elkon R., Comel A., Holstege H.,Kerkhoven R., Jonkers J., Voorhoeve P.M., Agami R., Del Sal G.;
Nat. Cell Biol. 12:380-389(2010).
Cited for: INTERACTION WITH BRD7, AND ACETYLATION AT LYS-382.
"Post-translational modification of p53 protein in response toionizing radiation analyzed by mass spectrometry.";
Abraham J., Kelly J., Thibault P., Benchimol S.;
J. Mol. Biol. 295:853-864(2000).
Cited for: ACETYLATION AT LYS-373 AND LYS-382.
"hSIR2(SIRT1) functions as an NAD-dependent p53 deacetylase.";
Vaziri H., Dessain S.K., Ng Eaton E., Imai S., Frye R.A.,Pandita T.K., Guarente L., Weinberg R.A.;
Cell 107:149-159(2001).
Cited for: DEACETYLATION AT LYS-382 BY SIRT1.
"Identification and characterization of a novel p300-mediated p53acetylation site, lysine 305.";
Wang Y.H., Tsay Y.G., Tan B.C., Lo W.Y., Lee S.C.;
J. Biol. Chem. 278:25568-25576(2003).
Cited for: ACETYLATION AT LYS-305.
Methylation
ReferencePubMed
"G9a and Glp methylate lysine 373 in the tumor suppressor p53.";
Huang J., Dorsey J., Chuikov S., Perez-Burgos L., Zhang X.,Jenuwein T., Reinberg D., Berger S.L.;
J. Biol. Chem. 285:9636-9641(2010).
Cited for: METHYLATION AT LYS-373, AND MUTAGENESIS OF LYS-373.
"The MBT repeats of L3MBTL1 link SET8-mediated p53 methylation atlysine 382 to target gene repression.";
West L.E., Roy S., Lachmi-Weiner K., Hayashi R., Shi X., Appella E.,Kutateladze T.G., Gozani O.;
J. Biol. Chem. 285:37725-37732(2010).
Cited for: X-RAY CRYSTALLOGRAPHY (2.50 ANGSTROMS) OF 377-386, METHYLATION ATLYS-382, MUTAGENESIS OF LYS-382, AND INTERACTION WITH L3MBTL1.
"Regulation of p53 activity through lysine methylation.";
Chuikov S., Kurash J.K., Wilson J.R., Xiao B., Justin N., Ivanov G.S.,McKinney K., Tempst P., Prives C., Gamblin S.J., Barlev N.A.,Reinberg D.;
Nature 432:353-360(2004).
Cited for: METHYLATION AT LYS-372, AND MUTAGENESIS OF LYS-372.
"Repression of p53 activity by Smyd2-mediated methylation.";
Huang J., Perez-Burgos L., Placek B.J., Sengupta R., Richter M.,Dorsey J.A., Kubicek S., Opravil S., Jenuwein T., Berger S.L.;
Nature 444:629-632(2006).
Cited for: METHYLATION AT LYS-370, AND MUTAGENESIS OF LYS-370.
"Structural basis for the methylation site specificity of SET7/9.";
Couture J.-F., Collazo E., Hauk G., Trievel R.C.;
Nat. Struct. Mol. Biol. 13:140-146(2006).
Cited for: MOTIF, AND METHYLATION AT LYS-372.
"Modulation of p53 function by SET8-mediated methylation at lysine382.";
Shi X., Kachirskaia I., Yamaguchi H., West L.E., Wen H., Wang E.W.,Dutta S., Appella E., Gozani O.;
Mol. Cell 27:636-646(2007).
Cited for: METHYLATION AT LYS-382, AND MUTAGENESIS OF LYS-382.
Phosphorylation
ReferencePubMed
"Large-scale proteomics analysis of the human kinome.";
Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G.,Mann M., Daub H.;
Mol. Cell. Proteomics 8:1751-1764(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-313; SER-314 ANDSER-392, AND MASS SPECTROMETRY.
"Isoform specific phosphorylation of p53 by protein kinase CK1.";
Venerando A., Marin O., Cozza G., Bustos V.H., Sarno S., Pinna L.A.;
Cell. Mol. Life Sci. 67:1105-1118(2010).
Cited for: PHOSPHORYLATION AT SER-20 BY CSNK1D/CK1.
"G-protein-coupled receptor kinase 5 phosphorylates p53 and inhibitsDNA damage-induced apoptosis.";
Chen X., Zhu H., Yuan M., Fu J., Zhou Y., Ma L.;
J. Biol. Chem. 285:12823-12830(2010).
Cited for: PHOSPHORYLATION AT THR-55, AND INTERACTION WITH GRK5.
"Aurora B interacts with NIR-p53, leading to p53 phosphorylation inits DNA-binding domain and subsequent functional suppression.";
Wu L., Ma C.A., Zhao Y., Jain A.;
J. Biol. Chem. 286:2236-2244(2011).
Cited for: FUNCTION, INTERACTION WITH AURKB AND NOC2L, PHOSPHORYLATION ATSER-183; SER-269 AND THR-284, CHARACTERIZATION OF VARIANT ALA-284,MUTAGENESIS OF SER-183 AND SER-269, AND MASS SPECTROMETRY.
"A new role of NUAK1: directly phosphorylating p53 and regulating cellproliferation.";
Hou X., Liu J.E., Liu W., Liu C.Y., Liu Z.Y., Sun Z.Y.;
Oncogene 30:2933-2942(2011).
Cited for: INTERACTION WITH NUAK1, AND PHOSPHORYLATION AT SER-15 AND SER-392.
"p53 is phosphorylated by CDK7-cyclin H in a p36MAT1-dependentmanner.";
Ko L.J., Shieh S.-Y., Chen X., Jayaraman L., Tamai K., Taya Y.,Prives C., Pan Z.-Q.;
Mol. Cell. Biol. 17:7220-7229(1997).
Cited for: PHOSPHORYLATION AT SER-33.
"Protein kinase CK1 is a p53-threonine 18 kinase which requires priorphosphorylation of serine 15.";
Dumaz N., Milne D.M., Meek D.W.;
FEBS Lett. 463:312-316(1999).
Cited for: PHOSPHORYLATION AT THR-18 BY CSNK1D/CK1.
"Phosphorylation of Ser-20 mediates stabilization of human p53 inresponse to DNA damage.";
Chehab N.H., Malikzay A., Stavridi E.S., Halazonetis T.D.;
Proc. Natl. Acad. Sci. U.S.A. 96:13777-13782(1999).
Cited for: PHOSPHORYLATION AT SER-15 AND SER-20, INDUCTION BY DNA DAMAGE,CHARACTERIZATION OF LFS VARIANT HIS-273, MUTAGENESIS OF THR-18; SER-20AND 22-LEU-TRP-23, SUBCELLULAR LOCATION, AND INTERACTION WITH PML ANDMDM2.
"The C-terminal regulatory domain of p53 contains a functional dockingsite for cyclin A.";
Luciani M.G., Hutchins J.R.A., Zheleva D., Hupp T.R.;
J. Mol. Biol. 300:503-518(2000).
Cited for: PHOSPHORYLATION AT SER-315 AND SER-392 BY CDK2, AND MUTAGENESIS OFLYS-382; LEU-383 AND PHE-385.
"The human vaccinia-related kinase 1 (VRK1) phosphorylates threonine-18 within the mdm-2 binding site of the p53 tumour suppressorprotein.";
Lopez-Borges S., Lazo P.A.;
Oncogene 19:3656-3664(2000).
Cited for: PHOSPHORYLATION AT THR-18.
"Cell cycle regulation via p53 phosphorylation by a 5'-AMP activatedprotein kinase activator, 5-aminoimidazole-4-carboxamide-1-beta-D-ribofuranoside, in a human hepatocellular carcinoma cell line.";
Imamura K., Ogura T., Kishimoto A., Kaminishi M., Esumi H.;
Biochem. Biophys. Res. Commun. 287:562-567(2001).
Cited for: PHOSPHORYLATION AT SER-15.
"Reactive oxygen species-induced phosphorylation of p53 on serine 20is mediated in part by polo-like kinase-3.";
Xie S., Wang Q., Wu H., Cogswell J., Lu L., Jhanwar-Uniyal M., Dai W.;
J. Biol. Chem. 276:36194-36199(2001).
Cited for: PHOSPHORYLATION AT SER-20 BY PLK3.
"Plk3 functionally links DNA damage to cell cycle arrest and apoptosisat least in part via the p53 pathway.";
Xie S., Wu H., Wang Q., Cogswell J.P., Husain I., Conn C.,Stambrook P., Jhanwar-Uniyal M., Dai W.;
J. Biol. Chem. 276:43305-43312(2001).
Cited for: PHOSPHORYLATION AT SER-20 BY PLK3.
"A DNA damage-induced p53 serine 392 kinase complex contains CK2,hSpt16, and SSRP1.";
Keller D.M., Zeng X., Wang Y., Zhang Q.H., Kapoor M., Shu H.,Goodman R., Lozano G., Zhao Y., Lu H.;
Mol. Cell 7:283-292(2001).
Cited for: PHOSPHORYLATION AT SER-392.
"Regulation of p53 activity by its interaction with homeodomain-interacting protein kinase-2.";
Hofmann T.G., Moeller A., Sirma H., Zentgraf H., Taya Y., Droege W.,Will H., Schmitz M.L.;
Nat. Cell Biol. 4:1-10(2002).
Cited for: INTERACTION WITH HIPK2, PHOSPHORYLATION AT SER-46, AND MUTAGENESIS OFSER-46 AND LYS-382.
"Homeodomain-interacting protein kinase-2 phosphorylates p53 at Ser 46and mediates apoptosis.";
D'Orazi G., Cecchinelli B., Bruno T., Manni I., Higashimoto Y.,Saito S., Gostissa M., Coen S., Marchetti A., Del Sal G., Piaggio G.,Fanciulli M., Appella E., Soddu S.;
Nat. Cell Biol. 4:11-19(2002).
Cited for: INTERACTION WITH HIPK2, AND PHOSPHORYLATION AT SER-46.
"The promyelocytic leukemia protein protects p53 from Mdm2-mediatedinhibition and degradation.";
Louria-Hayon I., Grossman T., Sionov R.V., Alsheich O., Pandolfi P.P.,Haupt Y.;
J. Biol. Chem. 278:33134-33141(2003).
Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH CHEK2 AND PML,UBIQUITINATION BY MDM2, AND PHOSPHORYLATION AT SER-20.
"Phosphorylation on Thr-55 by TAF1 mediates degradation of p53: a rolefor TAF1 in cell G1 progression.";
Li H.-H., Li A.G., Sheppard H.M., Liu X.;
Mol. Cell 13:867-878(2004).
Cited for: PHOSPHORYLATION AT THR-55, MUTAGENESIS OF THR-55, AND INTERACTION WITHTAF1.
"Phosphorylation by aurora kinase A induces Mdm2-mediateddestabilization and inhibition of p53.";
Katayama H., Sasai K., Kawai H., Yuan Z.M., Bondaruk J., Suzuki F.,Fujii S., Arlinghaus R.B., Czerniak B.A., Sen S.;
Nat. Genet. 36:55-62(2004).
Cited for: INTERACTION WITH AURKA, AND PHOSPHORYLATION AT SER-315.
"Tumor suppressor SMAR1 activates and stabilizes p53 through itsarginine-serine-rich motif.";
Jalota-Badhwar A., Singh K., Pavithra L., Kaul-Ghanekar R., Jameel S.,Chattopadhyay S.;
J. Biol. Chem. 280:16019-16029(2005).
Cited for: INTERACTION WITH BANP, SUBCELLULAR LOCATION, AND PHOSPHORYLATION ATSER-15.
"Global phosphoproteome of HT-29 human colon adenocarcinoma cells.";
Kim J.-E., Tannenbaum S.R., White F.M.;
J. Proteome Res. 4:1339-1346(2005).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-392, AND MASSSPECTROMETRY.
"AMP-activated protein kinase induces a p53-dependent metaboliccheckpoint.";
Jones R.G., Plas D.R., Kubek S., Buzzai M., Mu J., Xu Y.,Birnbaum M.J., Thompson C.B.;
Mol. Cell 18:283-293(2005).
Cited for: PHOSPHORYLATION AT SER-15.
"LKB1 is recruited to the p21/WAF1 promoter by p53 to mediatetranscriptional activation.";
Zeng P.Y., Berger S.L.;
Cancer Res. 66:10701-10708(2006).
Cited for: INTERACTION WITH STK11/LKB1, AND PHOSPHORYLATION AT SER-15 ANDSER-392.
"The subcellular localization of vaccinia-related kinase-2 (VRK2)isoforms determines their different effect on p53 stability in tumourcell lines.";
Blanco S., Klimcakova L., Vega F.M., Lazo P.A.;
FEBS J. 273:2487-2504(2006).
Cited for: PHOSPHORYLATION AT THR-18.
"Protein kinase C delta regulates Ser46 phosphorylation of p53 tumorsuppressor in the apoptotic response to DNA damage.";
Yoshida K., Liu H., Miki Y.;
J. Biol. Chem. 281:5734-5740(2006).
Cited for: PHOSPHORYLATION AT SER-46, AND INTERACTION WITH PRKCG.
"PRAK is essential for ras-induced senescence and tumor suppression.";
Sun P., Yoshizuka N., New L., Moser B.A., Li Y., Liao R., Xie C.,Chen J., Deng Q., Yamout M., Dong M.Q., Frangou C.G., Yates J.R. III,Wright P.E., Han J.;
Cell 128:295-308(2007).
Cited for: PHOSPHORYLATION AT SER-37, AND MUTAGENESIS OF SER-37.
"Novel homeodomain-interacting protein kinase family member, HIPK4,phosphorylates human p53 at serine 9.";
Arai S., Matsushita A., Du K., Yagi K., Okazaki Y., Kurokawa R.;
FEBS Lett. 581:5649-5657(2007).
Cited for: PHOSPHORYLATION AT SER-9.
"Stabilization and activation of p53 induced by Cdk5 contributes toneuronal cell death.";
Lee J.-H., Kim H.-S., Lee S.-J., Kim K.-T.;
J. Cell Sci. 120:2259-2271(2007).
Cited for: PHOSPHORYLATION AT SER-15; SER-33 AND SER-46, INTERACTION WITH CDK5,AND SUBCELLULAR LOCATION.
"Global proteomic profiling of phosphopeptides using electron transferdissociation tandem mass spectrometry.";
Molina H., Horn D.M., Tang N., Mathivanan S., Pandey A.;
Proc. Natl. Acad. Sci. U.S.A. 104:2199-2204(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-315, AND MASSSPECTROMETRY.
"ATM and ATR substrate analysis reveals extensive protein networksresponsive to DNA damage.";
Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III,Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N.,Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J.;
Science 316:1160-1166(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-99, AND MASSSPECTROMETRY.
"Serine 15 phosphorylation of p53 directs its interaction withB56gamma and the tumor suppressor activity of B56gamma-specificprotein phosphatase 2A.";
Shouse G.P., Cai X., Liu X.;
Mol. Cell. Biol. 28:448-456(2008).
Cited for: INTERACTION WITH PPP2CA; PPP2R1A AND PPP2R5C, PHOSPHORYLATION ATSER-15 BY ATM, AND MUTAGENESIS OF SER-15.
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-314; SER-315 ANDSER-392, AND MASS SPECTROMETRY.
Sumoylation
ReferencePubMed
"SUMO-1 conjugation in vivo requires both a consensus modificationmotif and nuclear targeting.";
Rodriguez M.S., Dargemont C., Hay R.T.;
J. Biol. Chem. 276:12654-12659(2001).
Cited for: SUMOYLATION AT LYS-386, SUBCELLULAR LOCATION, AND MUTAGENESIS OFPHE-385; LYS-386; THR-387 AND GLU-388.
Ubiquitylation
ReferencePubMed
"Differential regulation of p53 and p21 by MKRN1 E3 ligase controlscell cycle arrest and apoptosis.";
Lee E.-W., Lee M.-S., Camus S., Ghim J., Yang M.-R., Oh W., Ha N.-C.,Lane D.P., Song J.;
EMBO J. 28:2100-2113(2009).
Cited for: INTERACTION WITH MKRN1, MUTAGENESIS OF 291-LYS-LYS-292, ANDUBIQUITINATION AT LYS-291 AND LYS-292 BY MKRN1.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures