Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Plasminogen activator inhibitor 1  

UniProtKB / Swiss-Prot ID :  PAI1_HUMAN

Gene Name (Synonyms) : 
SERPINE1, PAI1, PLANH1  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Secreted. 

Protein Function :  Serine protease inhibitor. This inhibitor acts as 'bait' for tissue plasminogen activator, urokinase, protein C and matriptase-3/TMPRSS7. Its rapid interaction with PLAT may function as a major control point in the regulation of fibrinolysis. 

Protein Sequence MQMSPALTCLVLGLALVFGEGSAVHHPPSYVAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQ...
Predicted Secondary Structure CCHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCEEECCHHHHHHHHHHH...
Protein Variant
LocationDescription
15A -> T (in dbSNP:rs6092). VAR_007099
17V -> I (in dbSNP:rs6090). VAR_011750
25H -> P (in dbSNP:rs2227647). VAR_013086
209R -> H (in dbSNP:rs2227669). VAR_013087
255T -> N (in dbSNP:rs2227685). VAR_013088
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
232N-linked (Glc...)TNKFNYTEF
ECCCCEEEE
44.41HPRD
Link
232N-linked (GlcNAc...).TNKFNYTEF
ECCCCEEEE
44.41UniProtKB
Link
288N-linked (Glc...)HWKGNMTRL
HHHHCCCCE
25.56HPRD
Link
288N-linked (GlcNAc...).HWKGNMTRL
HHHHCCCCE
25.56UniProtKB
Link
360noneTVASSSTAV
EEECCCCEE
23.21HPRD
Link-
364noneSSTAVIVSA
CCCEEEEEE
4.50HPRD
Link-
379noneIIMDRPFLF
EEEECCEEE
13.39HPRD
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
A1AG1_HUMANphysical interactionMINT-16736MINT11418606
VTNC_HUMANdirect interactionEBI-1036671
intact12808446
UBQL4_HUMANphysical interactionEBI-955174
intact16713569
LRP1_HUMANin vitro
in vivo
HPRD:01418HPRD15001579
ELNE_HUMANin vitroHPRD:01418HPRD7521069
A1AG1_HUMANin vitro
yeast 2-hybrid
HPRD:01418HPRD11418606
IBP5_HUMANin vitro
in vivo
HPRD:01418HPRD9202242
PLMN_HUMANin vitroHPRD:01418HPRD11113116
PAI1_HUMANin vitroHPRD:01418HPRD10731421
UBQL4_HUMANyeast 2-hybridHPRD:01418HPRD16713569
ONCM_HUMANENSP00000223095STRING
TPA_HUMANENSP00000223095STRING
TPA_HUMANENSP00000223095STRING
TGFB1_HUMANENSP00000223095STRING
VTNC_HUMANENSP00000223095STRING
IBP5_HUMANENSP00000223095STRING
PROC_HUMANENSP00000223095STRING
INS_HUMANENSP00000223095STRING
INS_HUMANENSP00000223095STRING
IL6_HUMANENSP00000223095STRING
PPARA_HUMANENSP00000223095STRING
IL1A_HUMANENSP00000223095STRING
EPAS1_HUMANENSP00000223095STRING
P53_HUMANENSP00000223095STRING
A4_HUMANENSP00000223095STRING
PAI2_HUMANENSP00000223095STRING
MMP3_HUMANENSP00000223095STRING
IGF1B_HUMANENSP00000223095STRING
VEGFA_HUMANENSP00000223095STRING
A2MG_HUMANENSP00000223095STRING
SP1_HUMANENSP00000223095STRING
HSF1_HUMANENSP00000223095STRING
SMAD3_HUMANENSP00000223095STRING
TFE3_HUMANENSP00000223095STRING
MK08_HUMANENSP00000223095STRING
- top -

Disease Reference
Kegg disease
OMIM disease
613329Plasminogen activator inhibitor-1 deficiency (PAI-1D)
Drug Reference
DrugBank
DB00009Alteplase
DB00029Anistreplase
DB00055Drotrecogin alfa
DB00015Reteplase
DB00031Tenecteplase
DB00013Urokinase
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures