Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Pantothenate kinase 4  

UniProtKB / Swiss-Prot ID :  PANK4_HUMAN

Gene Name (Synonyms) : 
PANK4  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm (Probable). 

Protein Function :  Plays a role in the physiological regulation of the intracellular CoA concentration (By similarity). 

Protein Sequence MAECGASGSGSSGDSLDKSITLPPDEIFRNLENAKRFAIDIGGSLTKLAYYSTVQHKVAKVRSFDHSGKD...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCEECCCHHHHHHHHHHHHHHEECCCEEEEEEEECCHHHHHHHCCCCCCCCCC...
Protein Variant
LocationDescription
475E -> K (in a colorectal cancer sample;somatic mutation).
547A -> V (in dbSNP:rs7535528). VAR_027409
684Q -> R (in dbSNP:rs2494620). VAR_015170
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAECGA
---CCCCCC
22.31UniProtKB
Link-
63PhosphoserineAKVRSFDHS
HHCCCCCCC
37.70Phosphositeplus
Link-
118Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)NTETKVIQA
CCCEEEEEE
30.98Phosphositeplus
Link-
123PhosphothreonineVIQATGGGA
EEEEECCCH
21.71Phosphositeplus
Link-
129Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GGAYKFKDL
CCHHHHHHH
45.46Phosphositeplus
Link-
137Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LIEEKLRLK
HHCCCCCEE
26.56Phosphositeplus
Link-
171Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)FVYQKDSDP
EEECCCCCC
41.32Phosphositeplus
Link-
234Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TKTKKFDEL
CCCCCHHHH
64.38Phosphositeplus
Link-
278Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SSFGKSATA
HHHHHHHHC
34.60Phosphositeplus
Link-
288Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)QEFSKEDMA
CCCCCHHHH
64.15Phosphositeplus
Link-
387PhosphoserineYAGSSGLMS
HHCCCCEEE
34.72HPRD
Link-
404PhosphoserineQRARSGTFD
CCCCCCCHH
41.00HPRD
Link-
404PhosphoserineQRARSGTFD
CCCCCCCHH
41.00PhosphoELM
Link-
404PhosphoserineQRARSGTFD
CCCCCCCHH
41.00Phosphositeplus
Link-
406PhosphothreonineARSGTFDLL
CCCCCHHHH
18.41HPRD
Link-
406PhosphothreonineARSGTFDLL
CCCCCHHHH
18.41PhosphoELM
Link-
406PhosphothreonineARSGTFDLL
CCCCCHHHH
18.41Phosphositeplus
Link-
487Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KYWNKLQTL
HHHHHHHHH
28.03Phosphositeplus
Link-
590Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)FEEAKRKLQ
HHHHHHHHC
54.03Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
Q96FS5_HUMANphysical interactionMINT-64329MINT16169070
PEA15_HUMANphysical interactionEBI-737291
intact16169070
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures