Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Programmed cell death protein 5  

UniProtKB / Swiss-Prot ID :  PDCD5_MOUSE

Gene Name (Synonyms) : 
Pdcd5, Tfar19  

Species :  Mus musculus (Mouse). 

Subcellular Localization :   

Protein Function :  May function in the process of apoptosis (By similarity). 

Protein Sequence MADEELEALRKQRLAELQAKHGDPGDAAQQEAKQREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAV...
Predicted Secondary Structure CCCHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
119PhosphoserineKVMDSDEDD
CCCCCCCCC
25.46PhosphoELM
Link-
119PhosphoserineKVMDSDEDD
CCCCCCCCC
25.46Phosphositeplus
Link-
119PhosphoserineKVMDSDEDD
CCCCCCCCC
25.46SysPTM
Link-
119Phosphoserine.KVMDSDEDD
CCCCCCCCC
25.46UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Large scale localization of protein phosphorylation by use ofelectron capture dissociation mass spectrometry.";
Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J.;
Mol. Cell. Proteomics 8:904-912(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-119, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures