Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Phosphatidylethanolamine-binding protein 1  

UniProtKB / Swiss-Prot ID :  PEBP1_RAT

Gene Name (Synonyms) : 
Pebp1, Pbp, Pebp  

Species :  Rattus norvegicus (Rat). 

Subcellular Localization :  Cytoplasm. Membrane; Peripheral membrane protein. 

Protein Function :  Binds ATP, opioids and phosphatidylethanolamine. Has lower affinity for phosphatidylinositol and phosphatidylcholine. Serine protease inhibitor which inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activator and elastase (By similarity). Inhibits the kinase activity of RAF1 by inhibiting its activation and by dissociating the RAF1/MEK complex and acting as a competitive inhibitor of MEK phosphorylation (By similarity). HCNP may be involved in the function of the presynaptic cholinergic neurons of the central nervous system. HCNP increases the production of choline acetyltransferase but not acetylcholinesterase. Seems to be mediated by a specific receptor. 

Protein Sequence MAADISQWAGPLSLQEVDEPPQHALRVDYGGVTVDELGKVLTPTQVMNRPSSISWDGLDPGKLYTLVLTD...
Predicted Secondary Structure CCCCCCCCCCCEEEEECCCCCCEEEEEEECCCEEECCCCEECCHHHCCCCCEEEECCCCCCCEEEEEEEC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine; in peptide hippocampalcholinergic neurostimulating.---MAADIS
---CCCCCC
17.53UniProtKB
Link
51PhosphoserineMNRPSSISW
CCCCCEEEE
36.75Phosphositeplus
Link
51PhosphoserineMNRPSSISW
CCCCCEEEE
36.75SysPTM
Link
153PhosphoserineFKVESFRKK
CCHHHHHHH
33.08Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Purification and structural analysis of hippocampal cholinergicneurostimulating peptide.";
Ojika K., Kojima S., Ueki Y., Fukushima N., Hayashi K., Yamamoto M.;
Brain Res. 572:164-171(1992).
Cited for: PROTEIN SEQUENCE OF 2-12, AND ACETYLATION AT ALA-2.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures