Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Peroxidase C1A  

UniProtKB / Swiss-Prot ID :  PER1A_ARMRU

Gene Name (Synonyms) : 
PRXC1A, HPRC1  

Species :  Armoracia rusticana (Horseradish) (Armoracia laphatifolia). 

Subcellular Localization :  Secreted (Probable). Vacuole (Probable). Note=Carboxy-terminal extension appears to target the protein to vacuoles. 

Protein Function :  Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress. These functions might be dependent on each isozyme/isoform in each plant tissue. 

Protein Sequence MHFSSSSTLFTCITLIPLVCLILHASLSDAQLTPTFYDNSCPNVSNIVRDTIVNELRSDPRIAASILRLH...
Predicted Secondary Structure CCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCHHHHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
31Pyrrolidone carboxylic acid.LSDAQLTPT
CCCCCCCCC
51.35UniProtKB
Link
43N-linked (GlcNAc...).NSCPNVSNI
CCCHHHHHH
54.93UniProtKB
Link
87N-linked (GlcNAc...).ILLDNTTSF
CCCCCCCCC
45.27UniProtKB
Link
188N-linked (GlcNAc...).NVGLNRSSD
HCCCCCHHH
35.54UniProtKB
Link
216N-linked (GlcNAc...).DRLYNFSNT
CCCCCCCCC
38.16UniProtKB
Link
228N-linked (GlcNAc...).DPTLNTTYL
CCCCCHHHH
32.62UniProtKB
Link
244N-linked (GlcNAc...).PLNGNLSAL
CCCCCCCEE
29.74UniProtKB
Link
285N-linked (GlcNAc...).FSSPNATDT
HHCCCCCHH
58.37UniProtKB
Link
298N-linked (GlcNAc...).RSFANSTQT
HHHHCCHHH
43.51UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
N-linked Glycosylation
ReferencePubMed
"Covalent structure of the glycoprotein horseradish peroxidase(EC 1.11.1.7).";
Welinder K.G.;
FEBS Lett. 72:19-23(1976).
Cited for: PROTEIN SEQUENCE OF 31-338.
Pyrrolidone carboxylic acid
ReferencePubMed
"Covalent structure of the glycoprotein horseradish peroxidase(EC 1.11.1.7).";
Welinder K.G.;
FEBS Lett. 72:19-23(1976).
Cited for: PROTEIN SEQUENCE OF 31-338.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures