Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Peroxidase  

UniProtKB / Swiss-Prot ID :  PER_COPCI

Gene Name (Synonyms) : 
CIP1  

Species :  Coprinopsis cinerea (Inky cap fungus) (Hormographiella aspergillata). 

Subcellular Localization :  Secreted. 

Protein Function :   

Protein Sequence MKLSLLSTFAAVIIGALALPQGPGGGGSVTCPGGQSTSNSQCCVWFDVLDDLQTNFYQGSKCESPVRKIL...
Predicted Secondary Structure CHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHH...
Protein Variant
LocationDescription
99I -> V.
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
21Pyrrolidone carboxylic acid.LALPQGPGG
HHHHHCCCC
72.12UniProtKB
Link-
162N-linked (Glc...)TGRSNSSQP
CCCCCCCCC
44.30OGlycBase
Link
162N-linked (GlcNAc...) (high mannose).TGRSNSSQP
CCCCCCCCC
44.30UniProtKB
Link
358O-linked (Man)GPLPSLAPA
CCCCCCCCC
44.86OGlycBase
Link
358O-linked (Man...).GPLPSLAPA
CCCCCCCCC
44.86UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
N-linked Glycosylation
ReferencePubMed
"Three-dimensional structure of a recombinant peroxidase from Coprinuscinereus at 2.6-A resolution.";
Petersen J.F.W., Kadziola A., Larsen S.;
FEBS Lett. 339:291-296(1994).
Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS), AND GLYCOSYLATION AT ASN-162AND SER-358.
O-linked Glycosylation
ReferencePubMed
"Three-dimensional structure of a recombinant peroxidase from Coprinuscinereus at 2.6-A resolution.";
Petersen J.F.W., Kadziola A., Larsen S.;
FEBS Lett. 339:291-296(1994).
Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS), AND GLYCOSYLATION AT ASN-162AND SER-358.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures