Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Phosphoglycerate kinase  

UniProtKB / Swiss-Prot ID :  PGK_YEAST

Gene Name (Synonyms) : 
PGK1 YCR012W YCR12W  

Species :  Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). 

Subcellular Localization :  Cytoplasm. 

Protein Function :   

Protein Sequence MSLSSKLSVQDLDLKDKRVFIRVDFNVPLDGKKITSNQRIVAALPTIKYVLEHHPRYVVLASHLGRPNGE...
Predicted Secondary Structure CCCCCCCCEEECCCCCCEEEEEEEECCCCCCCEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylserine.---MSLSSK
---CCCCCC
36.64UniProtKB
Link-
4Phosphoserine-MSLSSKLS
-CCCCCCCC
20.37SysPTM
Link-
4Phosphoserine.-MSLSSKLS
-CCCCCCCC
20.37UniProtKB
Link-
5PhosphoserineMSLSSKLSV
CCCCCCCCE
42.80SysPTM
Link-
5Phosphoserine.MSLSSKLSV
CCCCCCCCE
42.80UniProtKB
Link-
8PhosphoserineSSKLSVQDL
CCCCCEEEC
22.82SysPTM
Link-
8Phosphoserine.SSKLSVQDL
CCCCCEEEC
22.82UniProtKB
Link-
36PhosphoserineKKITSNQRI
CEECCHHHH
34.14SysPTM
Link-
36Phosphoserine.KKITSNQRI
CEECCHHHH
34.14UniProtKB
Link-
76PhosphoserineNEKYSLAPV
CCCCCHHHH
29.17SysPTM
Link
76Phosphoserine.NEKYSLAPV
CCCCCHHHH
29.17UniProtKB
Link
93PhosphothreonineGKDVTFLND
CCCCEEECC
32.32SysPTM
Link
93Phosphothreonine.GKDVTFLND
CCCCEEECC
32.32UniProtKB
Link
110PhosphoserineAVKASAPGS
HHHCCCCCC
29.31SysPTM
Link
110Phosphoserine.AVKASAPGS
HHHCCCCCC
29.31UniProtKB
Link
114PhosphoserineSAPGSVILL
CCCCCEEEE
12.62SysPTM
Link
114Phosphoserine.SAPGSVILL
CCCCCEEEE
12.62UniProtKB
Link
130PhosphoserineEEEGSRKVD
CCCCCCCCC
32.01SysPTM
Link
130Phosphoserine.EEEGSRKVD
CCCCCCCCC
32.01UniProtKB
Link
154PhosphoserineHELSSLADV
HHHHHCCCE
39.95SysPTM
Link
154Phosphoserine.HELSSLADV
HHHHHCCCE
39.95UniProtKB
Link
203PhosphothreonineLENPTRPFL
HCCCCCCEE
63.66SysPTM
Link
203Phosphothreonine.LENPTRPFL
HCCCCCCEE
63.66UniProtKB
Link
241PhosphothreonineGMAFTFKKV
HHHHHHHHH
25.63SysPTM
Link
241Phosphothreonine.GMAFTFKKV
HHHHHHHHH
25.63UniProtKB
Link
331PhosphothreonineAKAKTIVWN
HHCCEEEEE
26.14SysPTM
Link
331Phosphothreonine.AKAKTIVWN
HHCCEEEEE
26.14UniProtKB
Link
376PhosphothreonineGDTATVAKK
CHHHHHHHH
24.08SysPTM
Link
376Phosphothreonine.GDTATVAKK
CHHHHHHHH
24.08UniProtKB
Link
391PhosphoserineISHVSTGGG
CCEEECCHH
18.86SysPTM
Link
391Phosphoserine.ISHVSTGGG
CCEEECCHH
18.86UniProtKB
Link
392PhosphothreonineSHVSTGGGA
CEEECCHHH
38.46SysPTM
Link
392Phosphothreonine.SHVSTGGGA
CEEECCHHH
38.46UniProtKB
Link
397PhosphoserineGGGASLELL
CHHHHHHHH
26.17SysPTM
Link
397Phosphoserine.GGGASLELL
CHHHHHHHH
26.17UniProtKB
Link
413Phosphoserine.VAFLSEKK
HHHHCCCC
40.70UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Quantitative phosphoproteomics applied to the yeast pheromonesignaling pathway.";
Gruhler A., Olsen J.V., Mohammed S., Mortensen P., Faergeman N.J.,Mann M., Jensen O.N.;
Mol. Cell. Proteomics 4:310-327(2005).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT SER-2, PHOSPHORYLATION AT SER-4,AND MASS SPECTROMETRY.
Phosphorylation
ReferencePubMed
"Quantitative phosphoproteomics applied to the yeast pheromonesignaling pathway.";
Gruhler A., Olsen J.V., Mohammed S., Mortensen P., Faergeman N.J.,Mann M., Jensen O.N.;
Mol. Cell. Proteomics 4:310-327(2005).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT SER-2, PHOSPHORYLATION AT SER-4,AND MASS SPECTROMETRY.
"Large-scale phosphorylation analysis of alpha-factor-arrestedSaccharomyces cerevisiae.";
Li X., Gerber S.A., Rudner A.D., Beausoleil S.A., Haas W., Villen J.,Elias J.E., Gygi S.P.;
J. Proteome Res. 6:1190-1197(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-154; THR-331 ANDTHR-392, AND MASS SPECTROMETRY.
"Analysis of phosphorylation sites on proteins from Saccharomycescerevisiae by electron transfer dissociation (ETD) massspectrometry.";
Chi A., Huttenhower C., Geer L.Y., Coon J.J., Syka J.E.P., Bai D.L.,Shabanowitz J., Burke D.J., Troyanskaya O.G., Hunt D.F.;
Proc. Natl. Acad. Sci. U.S.A. 104:2193-2198(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-36; SER-110; SER-114;SER-130 AND SER-397, AND MASS SPECTROMETRY.
"Proteome-wide identification of in vivo targets of DNA damagecheckpoint kinases.";
Smolka M.B., Albuquerque C.P., Chen S.H., Zhou H.;
Proc. Natl. Acad. Sci. U.S.A. 104:10364-10369(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-391 AND SER-413, ANDMASS SPECTROMETRY.
"A multidimensional chromatography technology for in-depthphosphoproteome analysis.";
Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.;
Mol. Cell. Proteomics 7:1389-1396(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-5; SER-8; SER-76;THR-93; SER-114; THR-203; THR-241; THR-331; THR-376; SER-391 ANDTHR-392, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures