Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Endopolygalacturonase I  

UniProtKB / Swiss-Prot ID :  PGLR1_ASPNG

Gene Name (Synonyms) : 
pgaI, pg1, pga1  

Species :  Aspergillus niger. 

Subcellular Localization :  Secreted (Probable). 

Protein Function :  Involved in maceration and soft-rotting of plant tissue. Hydrolyzes the 1,4-alpha glycosidic bonds of de-esterified pectate in the smooth region of the plant cell wall. 

Protein Sequence MHSYQLLGLAAVGSLVSAAPAPSRVSEFAKKASTCTFTSASEASESISSCSDVVLSSIEVPAGETLDLSD...
Predicted Secondary Structure CCHHHHHHHHHHHHHHCCCCCCCCHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCCCEEEECCCEEEECC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
44O-linked (Man).ASEASESIS
HHHHHHHHH
28.02UniProtKB
Link
46O-linked (Man).EASESISSC
HHHHHHHHH
25.85UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
O-linked Glycosylation
ReferencePubMed
"Structural insights into the processivity of endopolygalacturonase Ifrom Aspergillus niger.";
van Pouderoyen G., Snijder H.J., Benen J.A.E., Dijkstra B.W.;
FEBS Lett. 554:462-466(2003).
Cited for: X-RAY CRYSTALLOGRAPHY (1.7 ANGSTROMS) OF 33-368, AND GLYCOSYLATION ATSER-44; SER-46 AND ASN-246.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures