Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Phenylalanine-4-hydroxylase  

UniProtKB / Swiss-Prot ID :  PH4H_MOUSE

Gene Name (Synonyms) : 
Pah  

Species :  Mus musculus (Mouse). 

Subcellular Localization :   

Protein Function :   

Protein Sequence MAAVVLENGVLSRKLSDFGQETSYIEDNSNQNGAVSLIFSLKEEVGALAKVLRLFEENEINLTHIESRPS...
Predicted Secondary Structure CEEEEECCHHHHHHHHCCCCCCCEEEECCCCCCEEEEEEECCCCCCHHHHHHHHHHHCCCEEEEEECCCC...
Protein Variant
LocationDescription
106V -> A (in PAH-ENU1; mild PKU phenotype).
263F -> S (in PAH-ENU2; severe PKUphenotype).
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAAVVL
---CEEEEE
14.68UniProtKB
Link-
16PhosphoserineSRKLSDFGQ
HHHHHCCCC
33.65Phosphositeplus
Link-
97PhosphoserineSIIKSLRND
HHHHHHHHH
23.35Phosphositeplus
Link-
166PhosphotyrosineADIAYNYRH
HHHCCCCCC
17.04SysPTM
Link-
411PhosphoserinePRPFSVRYD
CCCCEEEEC
14.36Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures