Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Pterin-4-alpha-carbinolamine dehydratase  

UniProtKB / Swiss-Prot ID :  PHS_XENLA

Gene Name (Synonyms) : 
pcbd, dcoh  

Species :  Xenopus laevis (African clawed frog). 

Subcellular Localization :  Cytoplasm (By similarity). Nucleus (By similarity). Note=Cytoplasmic and/or nuclear (By similarity). 

Protein Function :  Involved in tetrahydrobiopterin biosynthesis. Seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2. Coactivator for HNF1A-dependent transcription. Regulates the dimerization of homeodomain protein HNF1A and enhances its transcriptional activity (By similarity). 

Protein Sequence MAGKVHRLSGEEREQLLPNLRAVGWHELDGRDAICKEFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVY...
Predicted Secondary Structure CCCCCCCCCHHHHHHHHHHCCCCCEEEECCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCEEEEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
There are no experimentally verified PTM sites.
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures