Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  p53-induced protein with a death domain  

UniProtKB / Swiss-Prot ID :  PIDD_MOUSE

Gene Name (Synonyms) : 
Pidd, Lrdd  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Cytoplasm. Nucleus (By similarity). 

Protein Function :  Promotes apoptosis downstream of the tumor suppressor as component of the DNA damage/stress response pathway that connects p53/TP53 to apoptosis. Associates with NEMO/IKBKG and RIP1 and enhances sumoylation and ubiquitination of NEMO/IKBKG which is important for activation of the transcription factor NF-kappa-B. Associates with CASP2/caspase-2 and CRADD/RAIDD, and induces activation of CASP2 which an important regulator in apoptotic pathways. 

Protein Sequence MAAVLEGQEPEETAAAAEDAATSTLEAVDAGPGAPFLPAGNQLNLDLRPGGCHRLQYLCSQQPPQLLQVE...
Predicted Secondary Structure CCCCCCCCCCHHHHCCCCHHHHHHHHHHCCCCCCCCCCCCCCCEEECCCCCHHHHHHHHCCCCCCCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
There are no experimentally verified PTM sites.
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures