Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Protein-L-isoaspartate(D-aspartate) O-methyltransferase  

UniProtKB / Swiss-Prot ID :  PIMT_HUMAN

Gene Name (Synonyms) : 
PCMT1  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  Catalyzes the methyl esterification of L-isoaspartyl and D-aspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins. Acts on microtubule-associated protein 2, calreticulin, clathrin light chains a and b, Ubiquitin carboxyl- terminal hydrolase isozyme L1, phosphatidylethanolamine-binding protein 1, stathmin, beta-synuclein and alpha-synuclein (By similarity). 

Protein Sequence MAWKSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNPYMDSPQSIGFQATISAPHMHAYALE...
Predicted Secondary Structure CCCHHHCCCHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHH...
Protein Variant
LocationDescription
120V -> I (in dbSNP:rs4816). VAR_006173
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAWKSG
---CCCHHH
23.54UniProtKB
Link
4Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)-MAWKSGGA
-CCCHHHCC
29.68Phosphositeplus
Link
105Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GCTGKVIGI
CCCCEEEEE
16.72Phosphositeplus
Link
113Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IDHIKELVD
EECCHHHHH
41.39Phosphositeplus
Link
197Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EQYDKLQDG
EEEEEECCC
43.01Phosphositeplus
Link
206Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SIKMKPLMG
EEEEEEECC
29.96Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
CBP_HUMANphysical interactionMINT-18045MINT11912212
CBP_HUMANphysical interactionMINT-18046MINT11912212
APOA1_HUMANphysical interactionEBI-737297
intact16169070
CHD3_HUMANphysical interactionEBI-735324
intact16169070
PIMT_HUMANphysical interactionEBI-1062487
intact17353931
CBP_HUMANin vitro
in vivo
HPRD:08908HPRD11912212
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Sequence of the D-aspartyl/L-isoaspartyl protein methyltransferasefrom human erythrocytes. Common sequence motifs for protein, DNA, RNA,and small molecule S-adenosylmethionine-dependentmethyltransferases.";
Ingrosso D., Fowler A.V., Bleibaum J., Clarke S.;
J. Biol. Chem. 264:20131-20139(1989).
Cited for: PROTEIN SEQUENCE (ISOFORM 1).
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures