Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Phosphatidylinositol transfer protein alpha isoform  

UniProtKB / Swiss-Prot ID :  PIPNA_HUMAN

Gene Name (Synonyms) : 
PITPNA, PITPN  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  Catalyzes the transfer of PtdIns and phosphatidylcholine between membranes. 

Protein Sequence MVLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGEKGQYTHKIYHLQSKVPT...
Predicted Secondary Structure CEEEECCCEEECCCCCHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCEEEEEEEECCCCHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
50Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EPYEKDGEK
CCCCCCCCC
66.25Phosphositeplus
Link
57PhosphotyrosineEKGQYTHKI
CCCCEEEEE
21.34PhosphoELM
Link
57PhosphotyrosineEKGQYTHKI
CCCCEEEEE
21.34Phosphositeplus
Link
57Phosphotyrosine.EKGQYTHKI
CCCCEEEEE
21.34UniProtKB
Link
58PhosphothreonineKGQYTHKIY
CCCEEEEEE
14.59Phosphositeplus
Link
86Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)NIHEKAWNA
EEEEECCCC
44.53Phosphositeplus
Link
93PhosphotyrosineNAYPYCRTV
CCCCEEEEE
5.06Phosphositeplus
Link
140PhosphotyrosineVEAVYIDIA
EEEEEEEEE
10.42Phosphositeplus
Link
152Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)QVLSKDYKA
CCCHHHCCC
62.00Phosphositeplus
Link
162Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EDPAKFKSI
CCHHHHHHC
59.73Phosphositeplus
Link
165PhosphoserineAKFKSIKTG
HHHHHCCCC
32.24Phosphositeplus
Link
165Phosphoserine (PKC_alpha)AKFKSIKTG
HHHHHCCCC
32.24PhosphoELM
Link
178Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GPNWKQELV
CCHHHHHHH
40.30Phosphositeplus
Link
201Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TVKFKWWGL
EEEEEEECC
36.00Phosphositeplus
Link
208Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GLQNKVENF
CCHHHHHHH
37.66Phosphositeplus
Link
215N6-acetyllysineNFIHKQERR
HHHHHHHHH
49.38HPRD
Link
215N6-acetyllysineNFIHKQERR
HHHHHHHHH
49.38Phosphositeplus
Link
215N6-acetyllysine.NFIHKQERR
HHHHHHHHH
49.38UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
MLKL_HUMANphysical interactionEBI-1086058
intact17353931
PMVK_HUMANphysical interactionEBI-1086166
intact17353931
HSDL1_HUMANphysical interactionEBI-1075646
intact17353931
MO4L2_HUMANphysical interactionEBI-1076683
intact17353931
EGFR_HUMANin vitro
in vivo
HPRD:02548HPRD7761838
PLCG1_HUMANin vitro
in vivo
HPRD:02548HPRD7761838
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-215, AND MASS SPECTROMETRY.
Phosphorylation
ReferencePubMed
"Global survey of phosphotyrosine signaling identifies oncogenickinases in lung cancer.";
Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J.,Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L.,Mitchell J., Wetzel R., Macneill J., Ren J.M., Yuan J.,Bakalarski C.E., Villen J., Kornhauser J.M., Smith B., Li D., Zhou X.,Gygi S.P., Gu T.-L., Polakiewicz R.D., Rush J., Comb M.J.;
Cell 131:1190-1203(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-57, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures