Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Serine/threonine-protein kinase N1  

UniProtKB / Swiss-Prot ID :  PKN1_MOUSE

Gene Name (Synonyms) : 
Pkn1, Pkn, Prk1, Prkcl1  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Cytoplasm (By similarity). Nucleus (By similarity). Endosome (By similarity). Cell membrane; Peripheral membrane protein (By similarity). Cleavage furrow (By similarity). Midbody (By similarity). Note=Associates with chromatin in a ligand-dependent manne 

Protein Function :  PKC-related serine/threonine-protein kinase involved in various processes such as regulation of the intermediate filaments of the actin cytoskeleton, cell migration, tumor cell invasion and transcription regulation. Regulates the cytoskeletal network by phosphorylating proteins such as VIM and neurofilament proteins NEFH, NEFL and NEFM, leading to inhibit their polymerization. Phosphorylates 'Ser-575', 'Ser-637' and 'Ser-669' of MAPT/Tau, lowering its ability to bind to microtubules, resulting in disruption of tubulin assembly. Acts as a key coactivator of androgen receptor (ANDR)-dependent transcription, by being recruited to ANDR target genes and specifically mediating phosphorylation of 'Thr-11' of histone H3 (H3T11ph), a specific tag for epigenetic transcriptional activation that promotes demethylation of histone H3 'Lys-9' (H3K9me) by KDM4C/JMJD2C. Phosphorylates HDAC5, HDAC7 and HDAC9, leading to impair their import in the nucleus. Phosphorylates 'Thr-38' of PPP1R14A, 'Ser- 159', 'Ser-163' and 'Ser-170', and GFAP. Able to phosphorylate RPS6 in vitro (By similarity). 

Protein Sequence MAGDAVQSEPRSWSLLEQLGLAGADLAAPGVQQQLELERERLKREIRKELKLKEGAENLRRATTDLGRSL...
Predicted Secondary Structure CCCCCCCCCCCCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
8PhosphoserineDAVQSEPRS
CCCCCCCCC
42.86Phosphositeplus
Link-
64PhosphothreonineRRATTDLGR
HHHHHHHHC
28.39Phosphositeplus
Link-
273PhosphoserineLLRESLERR
HHHHHHHHH
29.15Phosphositeplus
Link-
532PhosphothreonineSAVATGTFS
CCCCCCCCC
30.10Phosphositeplus
Link-
536PhosphoserineTGTFSPNAS
CCCCCCCCC
19.65Phosphositeplus
Link-
540PhosphoserineSPNASPGAE
CCCCCCCCC
30.43Phosphositeplus
Link-
772PhosphotyrosineEGMGYGDRT
HHCCCCCEE
13.63Phosphositeplus
Link-
776PhosphothreonineYGDRTSTFC
CCCEEEECC
36.54Phosphositeplus
Link-
777PhosphoserineGDRTSTFCG
CCEEEECCC
22.00Phosphositeplus
Link-
778PhosphothreonineDRTSTFCGT
CEEEECCCC
23.49Phosphositeplus
Link-
782PhosphothreonineTFCGTPEFL
ECCCCHHHC
22.33Phosphositeplus
Link-
918PhosphothreonineGEAPTLSPP
CCCCCCCCC
47.09Phosphositeplus
Link-
920PhosphoserineAPTLSPPRD
CCCCCCCCC
35.02PhosphoELM
Link-
920PhosphoserineAPTLSPPRD
CCCCCCCCC
35.02Phosphositeplus
Link-
920PhosphoserineAPTLSPPRD
CCCCCCCCC
35.02SysPTM
Link-
920Phosphoserine.APTLSPPRD
CCCCCCCCC
35.02UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Phosphoproteomic analysis of the developing mouse brain.";
Ballif B.A., Villen J., Beausoleil S.A., Schwartz D., Gygi S.P.;
Mol. Cell. Proteomics 3:1093-1101(2004).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-920, AND MASSSPECTROMETRY.
"The phagosomal proteome in interferon-gamma-activated macrophages.";
Trost M., English L., Lemieux S., Courcelles M., Desjardins M.,Thibault P.;
Immunity 30:143-154(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-920, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures