Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4  

UniProtKB / Swiss-Prot ID :  PLCB4_HUMAN

Gene Name (Synonyms) : 
PLCB4  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. This form has a role in retina signal transduction. 

Protein Sequence MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWRSEGKEGQVLECSLINSIRS...
Predicted Secondary Structure CCCCCCCCCCCCCHHHHHCCCEEEEEECCCEEECCCEEEEECCCEEEEEEECCCCCEEEEEECCCCCCCC...
Protein Variant
LocationDescription
21A -> T (in dbSNP:rs6077510). VAR_056694
710G -> S (in dbSNP:rs6118603). VAR_056695
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAKPYE
---CCCCCC
32.60UniProtKB
Link-
620PhosphoserineKRQMSRIYP
HHHHEEECC
13.74HPRD
Link-
620PhosphoserineKRQMSRIYP
HHHHEEECC
13.74SysPTM
Link-
620Phosphoserine.KRQMSRIYP
HHHHEEECC
13.74UniProtKB
Link-
623PhosphotyrosineMSRIYPKGG
HEEECCCCC
9.59HPRD
Link-
623PhosphotyrosineMSRIYPKGG
HEEECCCCC
9.59SysPTM
Link-
623Phosphotyrosine.MSRIYPKGG
HEEECCCCC
9.59UniProtKB
Link-
867PhosphoserineADVPSDTSK
CCCCCCCCC
54.06Phosphositeplus
Link-
886PhosphothreonineKANVTPQSS
CCCCCCCCC
18.54Phosphositeplus
Link-
890PhosphoserineTPQSSSELR
CCCCCCCCC
23.68HPRD
Link-
890PhosphoserineTPQSSSELR
CCCCCCCCC
23.68PhosphoELM
Link-
890PhosphoserineTPQSSSELR
CCCCCCCCC
23.68Phosphositeplus
Link-
890Phosphoserine.TPQSSSELR
CCCCCCCCC
23.68UniProtKB
Link-
1022Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AQHTKEWSE
HHHHHHHHH
55.87Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
NMDZ1_HUMANphysical interactionEBI-998685
intact16767099
- top -

Disease Reference
Kegg disease
OMIM disease
614669Auriculocondylar syndrome 2 (ARCND2)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Global, in vivo, and site-specific phosphorylation dynamics insignaling networks.";
Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,Mann M.;
Cell 127:635-648(2006).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-620 AND TYR-623, ANDMASS SPECTROMETRY.
"Global proteomic profiling of phosphopeptides using electron transferdissociation tandem mass spectrometry.";
Molina H., Horn D.M., Tang N., Mathivanan S., Pandey A.;
Proc. Natl. Acad. Sci. U.S.A. 104:2199-2204(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-890, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures