Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Polyamine-modulated factor 1  

UniProtKB / Swiss-Prot ID :  PMF1_HUMAN

Gene Name (Synonyms) : 
PMF1  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Nucleus. Chromosome, centromere, kinetochore. Note=Associated with the kinetochore. 

Protein Function :  Part of the MIS12 complex which is required for normal chromosome alignment and segregation and kinetochore formation during mitosis. May act as a cotranscription partner of NFE2L2 involved in regulation of polyamine-induced transcription of SSAT. 

Protein Sequence MAEASSANLGSGCEEKRHEGSSSESVPPGTTISRVKLLDTMVDTFLQKLVAAGSYQRFTDCYKCFYQLQP...
Predicted Secondary Structure CCCCCCCCCCCCHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCH...
Protein Variant
LocationDescription
75Q -> R (in dbSNP:rs1052053). VAR_034147
137M -> I (in dbSNP:rs1052067). VAR_034148
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAEASS
---CCCCCC
22.51UniProtKB
Link-
5PhosphoserineMAEASSANL
CCCCCCCCC
22.84Phosphositeplus
Link-
6PhosphoserineAEASSANLG
CCCCCCCCC
28.37HPRD
Link-
6PhosphoserineAEASSANLG
CCCCCCCCC
28.37Phosphositeplus
Link-
6Phosphoserine.AEASSANLG
CCCCCCCCC
28.37UniProtKB
Link-
11PhosphoserineANLGSGCEE
CCCCCCHHH
43.36HPRD
Link-
11Phosphoserine.ANLGSGCEE
CCCCCCHHH
43.36UniProtKB
Link-
21PhosphoserineRHEGSSSES
CCCCCCCCC
27.92Phosphositeplus
Link-
22PhosphoserineHEGSSSESV
CCCCCCCCC
49.32HPRD
Link-
22PhosphoserineHEGSSSESV
CCCCCCCCC
49.32Phosphositeplus
Link-
36Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ISRVKLLDT
HHHHHHHHH
42.07Phosphositeplus
Link-
48Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TFLQKLVAA
HHHHHHHHC
47.26Phosphositeplus
Link-
86PhosphothreonineAQLQTSIRE
HHHHHHHHH
34.41HPRD
Link-
86PhosphothreonineAQLQTSIRE
HHHHHHHHH
34.41Phosphositeplus
Link-
96Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ISDIKEEGN
HHHHHHCCC
55.49Phosphositeplus
Link-
154Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)RHVQKQEAE
HHHHHHHHH
49.36Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
DPYL1_HUMANphysical interactionMINT-65678MINT16169070
MED31_HUMANphysical interactionEBI-732878
intact16169070
DPYL1_HUMANphysical interactionEBI-732881
intact16169070
CSN6_HUMANphysical interactionEBI-730531
intact16169070
GDF9_HUMANphysical interactionEBI-735405
intact16169070
K1377_HUMANphysical interactionEBI-735408
intact16169070
NF2L2_HUMANin vitro
yeast 2-hybrid
HPRD:11441HPRD10419538
11256947
CSN7B_HUMANyeast 2-hybridHPRD:11441HPRD12020345
CSN6_HUMANyeast 2-hybridHPRD:11441HPRD16169070
MED31_HUMANyeast 2-hybridHPRD:11441HPRD16169070
K1377_HUMANyeast 2-hybridHPRD:11441HPRD16169070
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Evaluation of the low-specificity protease elastase for large-scalephosphoproteome analysis.";
Wang B., Malik R., Nigg E.A., Korner R.;
Anal. Chem. 80:9526-9533(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-6 AND SER-11,ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
Phosphorylation
ReferencePubMed
"Evaluation of the low-specificity protease elastase for large-scalephosphoproteome analysis.";
Wang B., Malik R., Nigg E.A., Korner R.;
Anal. Chem. 80:9526-9533(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-6 AND SER-11,ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures