Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Phenylethanolamine N-methyltransferase  

UniProtKB / Swiss-Prot ID :  PNMT_HUMAN

Gene Name (Synonyms) : 
PNMT, PENT  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  Converts noradrenaline to adrenaline. 

Protein Sequence MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEV...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCC...
Protein Variant
LocationDescription
9N -> S (in dbSNP:rs11569781). VAR_029351
98T -> A (lower activity levels than wild-type; dbSNP:rs36060376).
112R -> C (in dbSNP:rs34530498). VAR_036830
175A -> T (in dbSNP:rs34341496). VAR_036831
188S -> C (in dbSNP:rs5639). VAR_037611
211L -> H (in dbSNP:rs5640). VAR_037612
217L -> Q (in dbSNP:rs5641). VAR_037613
254R -> H (in dbSNP:rs5642). VAR_037614
276W -> R (in dbSNP:rs5643). VAR_024547
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
35PhosphotyrosineEPRAYLRNN
CCHHHHHHC
13.89HPRD
Link
35PhosphotyrosineEPRAYLRNN
CCHHHHHHC
13.89SysPTM
Link
40PhosphotyrosineLRNNYAPPR
HHHCCCCCC
24.84HPRD
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
COMT_HUMANENSP00000269582STRING
COMT_HUMANENSP00000269582STRING
COMT_HUMANENSP00000269582STRING
EGR1_HUMANENSP00000269582STRING
DOPO_HUMANENSP00000269582STRING
MAZ_HUMANENSP00000269582STRING
SP1_HUMANENSP00000269582STRING
AOFA_HUMANENSP00000269582STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures